Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23419_WB10.jpg WB (Western Blot) (WB Suggested Anti-PCK1 Antibody Titration: 1.0ug/mlPositive Control: Fetal Brain Lysate)

Rabbit PCK1 Polyclonal Antibody | anti-PCK1 antibody

PCK1 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
PCK1; PCKDC; PEPCK1; PEPCKC; PEPCK-C
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
PCK1, Antibody; PCK1 antibody - middle region; anti-PCK1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAS
Sequence Length
622
Applicable Applications for anti-PCK1 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 86%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PCK1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-PCK1 Antibody Titration: 1.0ug/mlPositive Control: Fetal Brain Lysate)

product-image-AAA23419_WB10.jpg WB (Western Blot) (WB Suggested Anti-PCK1 Antibody Titration: 1.0ug/mlPositive Control: Fetal Brain Lysate)

WB (Western Blot)

(Host: RabbitTarget Name: PCK1Sample Type: MCF7Antibody Dilution: 1.0ug/ml)

product-image-AAA23419_WB9.jpg WB (Western Blot) (Host: RabbitTarget Name: PCK1Sample Type: MCF7Antibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: PCK1Sample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

product-image-AAA23419_WB8.jpg WB (Western Blot) (Host: RabbitTarget Name: PCK1Sample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: PCK1Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

product-image-AAA23419_WB7.jpg WB (Western Blot) (Host: RabbitTarget Name: PCK1Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: PCK1Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

product-image-AAA23419_WB6.jpg WB (Western Blot) (Host: RabbitTarget Name: PCK1Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: PCK1Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

product-image-AAA23419_WB5.jpg WB (Western Blot) (Host: RabbitTarget Name: PCK1Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: PCK1Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

product-image-AAA23419_WB4.jpg WB (Western Blot) (Host: RabbitTarget Name: PCK1Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: PCK1Sample Tissue: Human MCF7 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA23419_WB3.jpg WB (Western Blot) (Host: RabbitTarget Name: PCK1Sample Tissue: Human MCF7 Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: PCK1Sample Tissue: Human MCF7 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA23419_WB2.jpg WB (Western Blot) (Host: RabbitTarget Name: PCK1Sample Tissue: Human MCF7 Whole CellAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(Human kidney)

product-image-AAA23419_IHC.jpg IHC (Immunohistochemistry) (Human kidney)
Related Product Information for anti-PCK1 antibody
This is a rabbit polyclonal antibody against PCK1. It was validated on Western Blot and immunohistochemistry

Target Description: PCK1 is a main control point for the regulation of gluconeogenesis. The cytosolic enzyme encoded by this gene, along with GTP, catalyzes the formation of phosphoenolpyruvate from oxaloacetate, with the release of carbon dioxide and GDP. The expression of PCK1 can be regulated by insulin, glucocorticoids, glucagon, cAMP, and diet.
Product Categories/Family for anti-PCK1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
69kDa
NCBI Official Full Name
phosphoenolpyruvate carboxykinase, cytosolic
NCBI Official Synonym Full Names
phosphoenolpyruvate carboxykinase 1
NCBI Official Symbol
PCK1
NCBI Official Synonym Symbols
PCKDC; PEPCK1; PEPCKC; PEPCK-C
NCBI Protein Information
phosphoenolpyruvate carboxykinase, cytosolic [GTP]
UniProt Protein Name
Phosphoenolpyruvate carboxykinase, cytosolic [GTP]
UniProt Gene Name
PCK1
UniProt Synonym Gene Names
PEPCK1; PEPCK-C
UniProt Entry Name
PCKGC_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The PCK1 pck1 (Catalog #AAA23419) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PCK1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PCK1 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the PCK1 pck1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NGFFGVAPGT SVKTNPNAIK TIQKNTIFTN VAETSDGGVY WEGIDEPLAS. It is sometimes possible for the material contained within the vial of "PCK1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.