Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23466_WB9.jpg WB (Western Blot) (WB Suggested Anti-PER2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Placenta)

Rabbit PER2 Polyclonal Antibody | anti-PER2 antibody

PER2 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
PER2; FASPS; FASPS1
Reactivity
Horse, Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PER2, Antibody; PER2 antibody - middle region; anti-PER2 antibody
Ordering
Host
Rabbit
Reactivity
Horse, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VAECVYCENKEKGNICIPYEEDIPSLGLSEVSDTKEDENGSPLNHRIEEQ
Sequence Length
1255
Applicable Applications for anti-PER2 antibody
WB (Western Blot)
Homology
Horse: 79%; Human: 100%; Mouse: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PER2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-PER2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Placenta)

product-image-AAA23466_WB9.jpg WB (Western Blot) (WB Suggested Anti-PER2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Placenta)

WB (Western Blot)

(Host: RabbitTarget Name: PER2Sample Type: Human JurkatAntibody Dilution: 1.0ug/mlPER2 is supported by BioGPS gene expression data to be expressed in Jurkat)

product-image-AAA23466_WB8.jpg WB (Western Blot) (Host: RabbitTarget Name: PER2Sample Type: Human JurkatAntibody Dilution: 1.0ug/mlPER2 is supported by BioGPS gene expression data to be expressed in Jurkat)

WB (Western Blot)

(Host: RabbitTarget Name: PER2Sample Type: Human HelaAntibody Dilution: 1.0ug/ml)

product-image-AAA23466_WB7.jpg WB (Western Blot) (Host: RabbitTarget Name: PER2Sample Type: Human HelaAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: PER2Sample Type: Hum. MCF7Antibody Dilution: 1.0ug/mlPER2 is supported by BioGPS gene expression data to be expressed in MCF7)

product-image-AAA23466_WB6.jpg WB (Western Blot) (Host: RabbitTarget Name: PER2Sample Type: Hum. MCF7Antibody Dilution: 1.0ug/mlPER2 is supported by BioGPS gene expression data to be expressed in MCF7)

WB (Western Blot)

(Host: RabbitTarget Name: PER2Sample Type: Hum. Fetal MuscleAntibody Dilution: 1.0ug/ml)

product-image-AAA23466_WB5.jpg WB (Western Blot) (Host: RabbitTarget Name: PER2Sample Type: Hum. Fetal MuscleAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: PER2Sample Type: Hum. Fetal LungAntibody Dilution: 1.0ug/ml)

product-image-AAA23466_WB4.jpg WB (Western Blot) (Host: RabbitTarget Name: PER2Sample Type: Hum. Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: PER2Sample Type: Hum. Fetal HeartAntibody Dilution: 1.0ug/ml)

product-image-AAA23466_WB3.jpg WB (Western Blot) (Host: RabbitTarget Name: PER2Sample Type: Hum. Fetal HeartAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: PER2Sample Type: Hum. Adult PlacentaAntibody Dilution: 1.0ug/ml)

product-image-AAA23466_WB2.jpg WB (Western Blot) (Host: RabbitTarget Name: PER2Sample Type: Hum. Adult PlacentaAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: PER2Sample Type: Hum. 721_BAntibody Dilution: 1.0ug/mlPER2 is supported by BioGPS gene expression data to be expressed in 721_B)

product-image-AAA23466_WB.jpg WB (Western Blot) (Host: RabbitTarget Name: PER2Sample Type: Hum. 721_BAntibody Dilution: 1.0ug/mlPER2 is supported by BioGPS gene expression data to be expressed in 721_B)
Related Product Information for anti-PER2 antibody
This is a rabbit polyclonal antibody against PER2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This gene is a member of the Period family of genes and is expressed in a circadian pattern in the suprachiasmatic nucleus, the primary circadian pacemaker in the mammalian brain. Genes in this family encode components of the circadian rhythms of locomotor activity, metabolism, and behavior. Circadian expression in the suprachiasmatic nucleus continues in constant darkness, and a shift in the light/dark cycle evokes a proportional shift of gene expression in the suprachiasmatic nucleus. The specific function of this gene is not yet known.This gene is a member of the Period family of genes and is expressed in a circadian pattern in the suprachiasmatic nucleus, the primary circadian pacemaker in the mammalian brain. Genes in this family encode components of the circadian rhythms of locomotor activity, metabolism, and behavior. Circadian expression in the suprachiasmatic nucleus continues in constant darkness, and a shift in the light/dark cycle evokes a proportional shift of gene expression in the suprachiasmatic nucleus. The specific function of this gene is not yet known. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
136kDa
NCBI Official Full Name
period circadian protein homolog 2
NCBI Official Synonym Full Names
period circadian regulator 2
NCBI Official Symbol
PER2
NCBI Official Synonym Symbols
FASPS; FASPS1
NCBI Protein Information
period circadian protein homolog 2
UniProt Protein Name
Period circadian protein homolog 2
UniProt Gene Name
PER2
UniProt Synonym Gene Names
KIAA0347; hPER2
UniProt Entry Name
PER2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The PER2 per2 (Catalog #AAA23466) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PER2 antibody - middle region reacts with Horse, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PER2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the PER2 per2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VAECVYCENK EKGNICIPYE EDIPSLGLSE VSDTKEDENG SPLNHRIEEQ. It is sometimes possible for the material contained within the vial of "PER2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.