Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282404_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of PC-12 cells using Perilipin-2 Rabbit pAb (AAA282404) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.)

Rabbit anti-Human, Rat Perilipin-2 Polyclonal Antibody | anti-PLIN2 antibody

Perilipin-2 Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
PLIN2; ADFP; ADRP
Reactivity
Human, Rat
Applications
Immunocytochemistry, Immunofluorescence, Western Blot
Purity
Affinity purification
Synonyms
Perilipin-2, Antibody; Perilipin-2 Rabbit pAb; ADFP; ADRP; anti-PLIN2 antibody
Ordering
Host
Rabbit
Reactivity
Human, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
Liquid
PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Sequence
NIQDQAKHMGVMAGDIYSVFRNAASFKEVSDSLLTSSKGQLQKMKESLDDVMDYLVNNTPLNWLVGPFYPQLTESQNAQDQGAEMDKSSQETQRSEHKTH
Applicable Applications for anti-PLIN2 antibody
ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot)
Positive Samples
HuH-7
Cellular Location
cytosol, endoplasmic reticulum, extracellular region, lipid droplet, nucleus, plasma membrane
Research Area
Cancer, Signal Transduction, Endocrine Metabolism, Lipid Metabolism, Cardiovascular, Hypoxia, Heart, Lipids, Cardiovascular diseases, Heart disease
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 338-437 of human Perilipin-2 (NP_001113.2).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Ship: Ice Pack

IF (Immunofluorescence)

(Immunofluorescence analysis of PC-12 cells using Perilipin-2 Rabbit pAb (AAA282404) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA282404_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of PC-12 cells using Perilipin-2 Rabbit pAb (AAA282404) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.)

WB (Western Blot)

(Western blot analysis of extracts of HuH-7, using Perilipin-2 Rabbit pAb (AAA282404) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s.)

product-image-AAA282404_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of HuH-7, using Perilipin-2 Rabbit pAb (AAA282404) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s.)
Related Product Information for anti-PLIN2 antibody
The protein encoded by this gene belongs to the perilipin family, members of which coat intracellular lipid storage droplets. This protein is associated with the lipid globule surface membrane material, and maybe involved in development and maintenance of adipose tissue. However, it is not restricted to adipocytes as previously thought, but is found in a wide range of cultured cell lines, including fibroblasts, endothelial and epithelial cells, and tissues, such as lactating mammary gland, adrenal cortex, Sertoli and Leydig cells, and hepatocytes in alcoholic liver cirrhosis, suggesting that it may serve as a marker of lipid accumulation in diverse cell types and diseases. Alternatively spliced transcript variants have been found for this gene.
Product Categories/Family for anti-PLIN2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
123
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48,075 Da
NCBI Official Full Name
perilipin-2
NCBI Official Synonym Full Names
perilipin 2
NCBI Official Symbol
PLIN2
NCBI Official Synonym Symbols
ADFP; ADRP
NCBI Protein Information
perilipin-2; adipophilin; adipose differentiation-related protein
UniProt Protein Name
Perilipin-2
UniProt Gene Name
PLIN2
UniProt Synonym Gene Names
ADFP; ADRP
UniProt Entry Name
PLIN2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The PLIN2 plin2 (Catalog #AAA282404) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Perilipin-2 Rabbit pAb reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Perilipin-2 can be used in a range of immunoassay formats including, but not limited to, ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the PLIN2 plin2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: NIQDQAKHMG VMAGDIYSVF RNAASFKEVS DSLLTSSKGQ LQKMKESLDD VMDYLVNNTP LNWLVGPFYP QLTESQNAQD QGAEMDKSSQ ETQRSEHKTH. It is sometimes possible for the material contained within the vial of "Perilipin-2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.