Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201484_WB11.jpg WB (Western Blot) (WB Suggested Anti-PKLR antibody Titration: 1 ug/mLSample Type: Human liver)

Rabbit anti-Human PKLR Polyclonal Antibody | anti-PKLR antibody

PKLR Antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
PKLR; PK1; PKL; RPK; PKRL
Reactivity
Human
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
PKLR, Antibody; PKLR Antibody - N-terminal region; anti-PKLR antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TVDPAFRTRGNANTVWVDYPNIVRVVPVGGRIYIDDGLISLVVQKIGPEG
Sequence Length
574
Applicable Applications for anti-PKLR antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human PKLR
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-PKLR antibody Titration: 1 ug/mLSample Type: Human liver)

product-image-AAA201484_WB11.jpg WB (Western Blot) (WB Suggested Anti-PKLR antibody Titration: 1 ug/mLSample Type: Human liver)

WB (Western Blot)

(Host: RabbitTarget Name: PKLRSample Type: NCI-H226 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

product-image-AAA201484_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: PKLRSample Type: NCI-H226 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

IHC (Immunohistochemistry)

(Rabbit Anti-PKLR AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult liverObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)

product-image-AAA201484_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-PKLR AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult liverObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)
Related Product Information for anti-PKLR antibody
This is a rabbit polyclonal antibody against PKLR. It was validated on Western Blot

Target Description: The protein encoded by this gene is a pyruvate kinase that catalyzes the transphosphorylation of phohsphoenolpyruvate into pyruvate and ATP, which is the rate-limiting step of glycolysis. Defects in this enzyme, due to gene mutations or genetic variations, are the common cause of chronic hereditary nonspherocytic hemolytic anemia (CNSHA or HNSHA). Multiple transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
63kDa
NCBI Official Full Name
pyruvate kinase PKLR isoform 2
NCBI Official Synonym Full Names
pyruvate kinase L/R
NCBI Official Symbol
PKLR
NCBI Official Synonym Symbols
PK1; PKL; RPK; PKRL
NCBI Protein Information
pyruvate kinase PKLR
UniProt Protein Name
Pyruvate kinase PKLR
UniProt Gene Name
PKLR
UniProt Synonym Gene Names
PK1; PKL
UniProt Entry Name
KPYR_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The PKLR pklr (Catalog #AAA201484) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PKLR Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PKLR can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the PKLR pklr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TVDPAFRTRG NANTVWVDYP NIVRVVPVGG RIYIDDGLIS LVVQKIGPEG. It is sometimes possible for the material contained within the vial of "PKLR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.