Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46387_IHC13.jpg IHC (Immunohiostchemistry) (Anti-PKLR Picoband antibody, AAA46387, IHC(P)IHC(P): Human Intestinal Cancer Tissue)

PKLR Polyclonal Antibody | anti-PKLR antibody

Anti-PKLR Antibody

Average rating 0.0
No ratings yet
Gene Names
PKLR; PK1; PKL; PKR; RPK; PKRL
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
PKLR, Antibody; Anti-PKLR Antibody; Pyruvate kinase PKLR; EC 2.7.1.40; KPYR_HUMAN; L-PK; Pk-1; PK1; PKL; Pklg; Pklr; PKR; PKRL; Pyruvate kinase 1; Pyruvate kinase isozymes R/L; Pyruvate kinase liver and blood cell; Pyruvate kinase liver and RBC; Pyruvate kinase liver and red blood cell; Pyruvate kinase liver type; Pyruvate kinase type L; Pyruvate kinase, red cell type; R type/L type pyruvate kinase; R-PK; R-type/L-type pyruvate kinase; Red cell/liver pyruvate kinase; RPK; pyruvate kinase, liver and RBC; anti-PKLR antibody
Ordering
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
574
Applicable Applications for anti-PKLR antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human PKLR (522-552aa EAIWADDVDRRVQFGIESGKLRGFLRVGDLV), different from the related mouse sequence by one amino acid, and identical to the rat sequence.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohiostchemistry)

(Anti-PKLR Picoband antibody, AAA46387, IHC(P)IHC(P): Human Intestinal Cancer Tissue)

product-image-AAA46387_IHC13.jpg IHC (Immunohiostchemistry) (Anti-PKLR Picoband antibody, AAA46387, IHC(P)IHC(P): Human Intestinal Cancer Tissue)

WB (Western Blot)

(Anti-PKLR Picoband antibody, AAA46387, Western blottingAll lanes: Anti PKLR (AAA46387) at 0.5ug/mlLane 1: Rat Liver Tissue Lysate at 50ugLane 2: Mouse Liver Tissue Lysate at 50ugPredicted bind size: 62KDObserved bind size: 62KD)

product-image-AAA46387_WB15.jpg WB (Western Blot) (Anti-PKLR Picoband antibody, AAA46387, Western blottingAll lanes: Anti PKLR (AAA46387) at 0.5ug/mlLane 1: Rat Liver Tissue Lysate at 50ugLane 2: Mouse Liver Tissue Lysate at 50ugPredicted bind size: 62KDObserved bind size: 62KD)
Related Product Information for anti-PKLR antibody
Description: Rabbit IgG polyclonal antibody for Pyruvate kinase PKLR(PKLR) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: Pyruvate kinase isozymes R/L is an enzyme that in humans is encoded by the PKLR gene. It is mapped to 1q21. The protein encoded by this gene is a pyruvate kinase that catalyzes the transphosphorylation of phohsphoenolpyruvate into pyruvate and ATP, which is the rate-limiting step of glycolysis. Defects in this enzyme, due to gene mutations or genetic variations, are the common cause of chronic hereditary nonspherocytic hemolytic anemia (CNSHA or HNSHA). Multiple transcript variants encoding different isoforms have been found for this gene.
References
1. "Entrez Gene: PKLR pyruvate kinase, liver and RBC". 2. Tani K, Fujii H, Tsutsumi H, Sukegawa J, Toyoshima K, Yoshida MC, Noguchi T, Tanaka T, Miwa S (Apr 1987). "Human liver type pyruvate kinase: cDNA cloning and chromosomal assignment". Biochem Biophys Res Commun 143 (2): 431-8.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58,494 Da
NCBI Official Full Name
pyruvate kinase PKLR isoform 1
NCBI Official Synonym Full Names
pyruvate kinase, liver and RBC
NCBI Official Symbol
PKLR
NCBI Official Synonym Symbols
PK1; PKL; PKR; RPK; PKRL
NCBI Protein Information
pyruvate kinase PKLR
UniProt Protein Name
Pyruvate kinase PKLR
UniProt Gene Name
PKLR
UniProt Synonym Gene Names
PK1; PKL
UniProt Entry Name
KPYR_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The PKLR pklr (Catalog #AAA46387) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-PKLR Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PKLR can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the PKLR pklr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PKLR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.