<
WB (Western Blot)
(WB Suggested Anti-PLK2 AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)
Rabbit PLK2 Polyclonal Antibody | anti-PLK2 antibody
PLK2 antibody - middle region
Gene Names
PLK2; SNK; hSNK; hPlk2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
PLK2, Antibody; PLK2 antibody - middle region; anti-PLK2 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SDIWALGCVMYTMLLGRPPFETTNLKETYRCIREARYTMPSSLLAPAKHL
Sequence Length
685
Applicable Applications for anti-PLK2 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-PLK2 AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)
WB (Western Blot)
(WB Suggested Anti-PLK2 AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)
WB (Western Blot)
(Host: RatTarget Name: PLK2Sample Tissue: Rat Skeletal MuscleAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: RatTarget Name: PLK2Sample Tissue: Rat Skeletal MuscleAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: PLK2Sample Tissue: Rat Skeletal MuscleAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: PLK2Sample Tissue: Rat Skeletal MuscleAntibody Dilution: 1ug/ml)
IHC (Immunohistochemistry)
(Rabbit Anti-PLK2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: Cytoplasmic in endothelial cells in blood vesselsPrimary Antibody Concentration: N/AOther Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
IHC (Immunohistochemistry)
(Rabbit Anti-PLK2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: Cytoplasmic in endothelial cells in blood vesselsPrimary Antibody Concentration: N/AOther Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-PLK2 antibody
This is a rabbit polyclonal antibody against PLK2. It was validated on Western Blot
Target Description: Serum-inducible kinase is a member of the 'polo' family of serine/threonine protein kinases that have a role in normal cell division.
Target Description: Serum-inducible kinase is a member of the 'polo' family of serine/threonine protein kinases that have a role in normal cell division.
Product Categories/Family for anti-PLK2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
78kDa
NCBI Official Full Name
serine/threonine-protein kinase PLK2 isoform 1
NCBI Official Synonym Full Names
polo like kinase 2
NCBI Official Symbol
PLK2
NCBI Official Synonym Symbols
SNK; hSNK; hPlk2
NCBI Protein Information
serine/threonine-protein kinase PLK2
UniProt Protein Name
Serine/threonine-protein kinase PLK2
UniProt Gene Name
PLK2
UniProt Synonym Gene Names
SNK; PLK-2; hPlk2; hSNK
UniProt Entry Name
PLK2_HUMAN
Similar Products
Product Notes
The PLK2 plk2 (Catalog #AAA200224) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PLK2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PLK2 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the PLK2 plk2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SDIWALGCVM YTMLLGRPPF ETTNLKETYR CIREARYTMP SSLLAPAKHL. It is sometimes possible for the material contained within the vial of "PLK2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.