Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198525_WB11.jpg WB (Western Blot) (WB Suggested Anti-PML Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: ACHN cell lysateThere is BioGPS gene expression data showing that PML is expressed in ACHN)

Rabbit anti-Human PML Polyclonal Antibody | anti-PML antibody

PML antibody - middle region

Gene Names
PML; MYL; RNF71; PP8675; TRIM19
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PML, Antibody; PML antibody - middle region; anti-PML antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Specificity
isoform 1, 9, 10 and 11 specific
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TTLPPAQPAFNLQALGTYFEGLLEGPALARAEGVSTPLAGRGLAERASQQ
Sequence Length
882
Applicable Applications for anti-PML antibody
WB (Western Blot)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PML
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-PML Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: ACHN cell lysateThere is BioGPS gene expression data showing that PML is expressed in ACHN)

product-image-AAA198525_WB11.jpg WB (Western Blot) (WB Suggested Anti-PML Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: ACHN cell lysateThere is BioGPS gene expression data showing that PML is expressed in ACHN)

WB (Western Blot)

(PML antibody - middle region validated by WB using Neuroblastoma at 1:500.)

product-image-AAA198525_WB13.jpg WB (Western Blot) (PML antibody - middle region validated by WB using Neuroblastoma at 1:500.)

WB (Western Blot)

(Host: RabbitTarget Name: SERPINA3Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

product-image-AAA198525_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: SERPINA3Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-PML antibody
This is a rabbit polyclonal antibody against PML. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PML is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. PML localizes to nuclear bodies where it functions as a transcription factor an

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
97kDa
NCBI Official Full Name
protein PML isoform 1
NCBI Official Synonym Full Names
promyelocytic leukemia
NCBI Official Symbol
PML
NCBI Official Synonym Symbols
MYL; RNF71; PP8675; TRIM19
NCBI Protein Information
protein PML
UniProt Protein Name
Protein PML
UniProt Gene Name
PML
UniProt Synonym Gene Names
MYL; PP8675; RNF71; TRIM19
UniProt Entry Name
PML_HUMAN

Similar Products

Product Notes

The PML pml (Catalog #AAA198525) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PML antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PML can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the PML pml for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TTLPPAQPAF NLQALGTYFE GLLEGPALAR AEGVSTPLAG RGLAERASQQ. It is sometimes possible for the material contained within the vial of "PML, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.