Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201125_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: POLR2ASample Type: Hela whole cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit POLR2A Polyclonal Antibody | anti-POLR2A antibody

POLR2A Antibody - N-terminal region

Gene Names
POLR2A; RPB1; RPO2; POLR2; POLRA; RPBh1; RPOL2; RpIILS; hsRPB1; hRPB220
Reactivity
Tested: Human; Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
POLR2A, Antibody; POLR2A Antibody - N-terminal region; anti-POLR2A antibody
Ordering
Host
Rabbit
Reactivity
Tested: Human; Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: DNKFGVEQPEGDEDLTKEKGHGGCGRYQPRIRRSGLELYAEWKHVNEDSQ
Sequence Length
566
Applicable Applications for anti-POLR2A antibody
WB (Western Blot)
Protein Size (# AA)
566 amino acids
Blocking Peptide
For anti-POLR2A (MBS3215452) antibody is Catalog # MBS3240356
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human POLR2A
Predicted Homology Based on Immunogen Sequence
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Replacement Item
This antibody may replace item sc-17798 from Santa Cruz Biotechnology.
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: POLR2ASample Type: Hela whole cell lysatesAntibody Dilution: 1.0ug/ml)

product-image-AAA201125_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: POLR2ASample Type: Hela whole cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-POLR2A antibody
This gene encodes the largest subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. The product of this gene contains a carboxy terminal domain composed of heptapeptide repeats that are essential for polymerase activity. These repeats contain serine and threonine residues that are phosphorylated in actively transcribing RNA polymerase. In addition, this subunit, in combination with several other polymerase subunits, forms the DNA binding domain of the polymerase, a groove in which the DNA template is transcribed into RNA.
Product Categories/Family for anti-POLR2A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
62kDa
NCBI Official Full Name
POLR2A protein
NCBI Official Synonym Full Names
RNA polymerase II subunit A
NCBI Official Symbol
POLR2A
NCBI Official Synonym Symbols
RPB1; RPO2; POLR2; POLRA; RPBh1; RPOL2; RpIILS; hsRPB1; hRPB220
NCBI Protein Information
DNA-directed RNA polymerase II subunit RPB1
UniProt Protein Name
DNA-directed RNA polymerase
UniProt Gene Name
POLR2A
UniProt Entry Name
Q6NX41_HUMAN

Similar Products

Product Notes

The POLR2A polr2a (Catalog #AAA201125) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The POLR2A Antibody - N-terminal region reacts with Tested: Human; Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's POLR2A can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the POLR2A polr2a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DNKFGVEQPE GDEDLTKEKG HGGCGRYQPR IRRSGLELYA EWKHVNEDSQ. It is sometimes possible for the material contained within the vial of "POLR2A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.