WB (Western Blot)
(WB Suggested Anti-Ppargc1a Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Mouse Brain)
Rabbit Ppargc1a Polyclonal Antibody | anti-PPARGC1A antibody
Ppargc1a antibody - C-terminal region
Gene Names
Ppargc1a; Pgc1; PGC-1; Pgco1; Gm11133; Ppargc1; Pgc-1alpha; A830037N07Rik; PPARGC-1-alpha
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Ppargc1a, Antibody; Ppargc1a antibody - C-terminal region; anti-PPARGC1A antibody
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LENGYTLRRSNETDFELYFCGRKQFFKSNYADLDTNSDDFDPASTKSKYD
Sequence Length
797
Applicable Applications for anti-PPARGC1A antibody
WB (Western Blot)
Homology
Cow: 86%; Dog: 100%; Goat: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Mouse
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-Ppargc1a Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Mouse Brain)
WB (Western Blot)
(WB Suggested Anti-Ppargc1a Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Mouse Brain)
WB (Western Blot)
(Lanes:Lane1: 20 ug cytosolic fraction mesangial cellsLane2: 20 ug cytosolic fraction mesangial cellsLane3: 20 ug mitochondrial fraction mesangial cellsLane4: 20 ug treated cytosolic fraction mesangial cellsLane5: 20 ug Myometrial tissue lysatePrimary Antibody Dilution:1:500Secondary Antibody:Goat anti-rabbit HRPSecondary Antibody Dilution:1:10000Gene Name:PGC1 alphaSubmitted by:Hiten Mistry, Ania Czajka and Marta Hentschke Ribeiro, King's College London)
WB (Western Blot)
(Lanes:Lane1: 20 ug cytosolic fraction mesangial cellsLane2: 20 ug cytosolic fraction mesangial cellsLane3: 20 ug mitochondrial fraction mesangial cellsLane4: 20 ug treated cytosolic fraction mesangial cellsLane5: 20 ug Myometrial tissue lysatePrimary Antibody Dilution:1:500Secondary Antibody:Goat anti-rabbit HRPSecondary Antibody Dilution:1:10000Gene Name:PGC1 alphaSubmitted by:Hiten Mistry, Ania Czajka and Marta Hentschke Ribeiro, King's College London)
Related Product Information for anti-PPARGC1A antibody
This is a rabbit polyclonal antibody against Ppargc1a. It was validated on Western Blot
Target Description: Ppargc1a is a transcriptional coactivator for steroid receptors and nuclear receptors. Ppargc1a greatly increases the transcriptional activity of PPARG and thyroid hormone receptor on the uncoupling protein promoter. Ppargc1a can regulate key mitochondrial genes that contribute to the program of adaptive thermogenesis.
Target Description: Ppargc1a is a transcriptional coactivator for steroid receptors and nuclear receptors. Ppargc1a greatly increases the transcriptional activity of PPARG and thyroid hormone receptor on the uncoupling protein promoter. Ppargc1a can regulate key mitochondrial genes that contribute to the program of adaptive thermogenesis.
Product Categories/Family for anti-PPARGC1A antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
90kDa
NCBI Official Full Name
peroxisome proliferator-activated receptor gamma coactivator 1-alpha
NCBI Official Synonym Full Names
peroxisome proliferative activated receptor, gamma, coactivator 1 alpha
NCBI Official Symbol
Ppargc1a
NCBI Official Synonym Symbols
Pgc1; PGC-1; Pgco1; Gm11133; Ppargc1; Pgc-1alpha; A830037N07Rik; PPARGC-1-alpha
NCBI Protein Information
peroxisome proliferator-activated receptor gamma coactivator 1-alpha
UniProt Protein Name
Peroxisome proliferator-activated receptor gamma coactivator 1-alpha
UniProt Gene Name
Ppargc1a
UniProt Synonym Gene Names
Pgc1; Pgc1a; Ppargc1; PGC-1-alpha; PPAR-gamma coactivator 1-alpha; PPARGC-1-alpha
Similar Products
Product Notes
The PPARGC1A ppargc1a (Catalog #AAA198430) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Ppargc1a antibody - C-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Ppargc1a can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the PPARGC1A ppargc1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LENGYTLRRS NETDFELYFC GRKQFFKSNY ADLDTNSDDF DPASTKSKYD. It is sometimes possible for the material contained within the vial of "Ppargc1a, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.