Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200243_WB13.jpg WB (Western Blot) (WB Suggested Anti-PRDX3 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysatePRDX3 is supported by BioGPS gene expression data to be expressed in Jurkat)

Rabbit anti-Human PRDX3 Polyclonal Antibody | anti-PRDX3 antibody

PRDX3 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
PRDX3; AOP1; MER5; AOP-1; SP-22; HBC189; PRO1748; prx-III
Reactivity
Human
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
PRDX3, Antibody; PRDX3 antibody - N-terminal region; anti-PRDX3 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AIPWGISATAALRPAACGRTSLTNLLCSGSSQAPYFKGTAVVNGEFKDLS
Sequence Length
238
Applicable Applications for anti-PRDX3 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PRDX3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-PRDX3 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysatePRDX3 is supported by BioGPS gene expression data to be expressed in Jurkat)

product-image-AAA200243_WB13.jpg WB (Western Blot) (WB Suggested Anti-PRDX3 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysatePRDX3 is supported by BioGPS gene expression data to be expressed in Jurkat)

IHC (Immunohistochemistry)

(Rabbit Anti-PRDX3 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA200243_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-PRDX3 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-PRDX3 antibody
This is a rabbit polyclonal antibody against PRDX3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PRDX3 is a protein with antioxidant function and is localized in the mitochondrion. Expression of this gene product in E. coli deficient in the C22-subunit gene rescued resistance of the bacteria to alkylhydroperoxide. The human and mouse genes are highly conserved, and they map to the regions syntenic between mouse and human chromosomes. Sequence comparisons with recently cloned mammalian homologues suggest that these genes consist of a family that is responsible for regulation of cellular proliferation, differentiation, and antioxidant functions. This gene encodes a protein with antioxidant function and is localized in the mitochondrion. This gene shows significant nucleotide sequence similarity to the gene coding for the C22 subunit of Salmonella typhimurium alkylhydroperoxide reductase. Expression of this gene product in E. coli deficient in the C22-subunit gene rescued resistance of the bacteria to alkylhydroperoxide. The human and mouse genes are highly conserved, and they map to the regions syntenic between mouse and human chromosomes. Sequence comparisons with recently cloned mammalian homologues suggest that these genes consist of a family that is responsible for regulation of cellular proliferation, differentiation, and antioxidant functions. Two transcript variants encoding two different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26kDa
NCBI Official Synonym Full Names
peroxiredoxin 3
NCBI Official Symbol
PRDX3
NCBI Official Synonym Symbols
AOP1; MER5; AOP-1; SP-22; HBC189; PRO1748; prx-III
NCBI Protein Information
thioredoxin-dependent peroxide reductase, mitochondrial
UniProt Protein Name
Thioredoxin-dependent peroxide reductase, mitochondrial
UniProt Gene Name
PRDX3
UniProt Synonym Gene Names
AOP1; AOP-1; Prx-III
UniProt Entry Name
PRDX3_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The PRDX3 prdx3 (Catalog #AAA200243) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PRDX3 antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PRDX3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the PRDX3 prdx3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AIPWGISATA ALRPAACGRT SLTNLLCSGS SQAPYFKGTA VVNGEFKDLS. It is sometimes possible for the material contained within the vial of "PRDX3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.