WB (Western Blot)
(WB Suggested Anti-PRKACB Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HCT15 cell lysate)
Rabbit PRKACB Polyclonal Antibody | anti-PRKACB antibody
PRKACB antibody - N-terminal region
Gene Names
PRKACB; PKACB; PKA C-beta
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PRKACB, Antibody; PRKACB antibody - N-terminal region; anti-PRKACB antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MGNAATAKKGSEVESVKEFLAKAKEDFLKKWENPTQNNAGLEDFERKKTL
Sequence Length
257
Applicable Applications for anti-PRKACB antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PRKACB
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-PRKACB Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HCT15 cell lysate)
WB (Western Blot)
(WB Suggested Anti-PRKACB Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HCT15 cell lysate)
WB (Western Blot)
(Host: MouseTarget Name: PRKACBSample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: MouseTarget Name: PRKACBSample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)
Related Product Information for anti-PRKACB antibody
This is a rabbit polyclonal antibody against PRKACB. It was validated on Western Blot
Target Description: cAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase, which transduces the signal through phosphorylation of different target proteins. The inactive kinase holoenzyme is a tetramer composed of two regulatory and two catalytic subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits have been identified in humans. The protein encoded by this gene is a member of the Ser/Thr protein kinase family and is a catalytic subunit of cAMP-dependent protein kinase.
Target Description: cAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase, which transduces the signal through phosphorylation of different target proteins. The inactive kinase holoenzyme is a tetramer composed of two regulatory and two catalytic subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits have been identified in humans. The protein encoded by this gene is a member of the Ser/Thr protein kinase family and is a catalytic subunit of cAMP-dependent protein kinase.
Product Categories/Family for anti-PRKACB antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28kDa
NCBI Official Full Name
cAMP-dependent protein kinase catalytic subunit beta isoform 3
NCBI Official Synonym Full Names
protein kinase cAMP-activated catalytic subunit beta
NCBI Official Symbol
PRKACB
NCBI Official Synonym Symbols
PKACB; PKA C-beta
NCBI Protein Information
cAMP-dependent protein kinase catalytic subunit beta
UniProt Protein Name
cAMP-dependent protein kinase catalytic subunit beta
UniProt Gene Name
PRKACB
UniProt Synonym Gene Names
PKA C-beta
UniProt Entry Name
KAPCB_HUMAN
Similar Products
Product Notes
The PRKACB prkacb (Catalog #AAA200592) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PRKACB antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PRKACB can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the PRKACB prkacb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MGNAATAKKG SEVESVKEFL AKAKEDFLKK WENPTQNNAG LEDFERKKTL. It is sometimes possible for the material contained within the vial of "PRKACB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.