Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA21314_IHC7.jpg IHC (Immunohistochemistry) (PSMA1 Antibody-Immunohistochemistry of paraffin-embedded mouse heart using PSMA1 antibody at dilution of 1:100 (400x lens).)

Rabbit anti-Mouse, Human PSMA1 Polyclonal Antibody | anti-PSMA1 antibody

PSMA1 Rabbit anti-Human Polyclonal Antibody

Average rating 0.0
No ratings yet
Gene Names
PSMA1; NU; HC2; PROS30; HEL-S-275
Reactivity
Mouse, Human
Applications
Immunofluorescence, Immunohistochemistry, Immunohistochemistry, Western Blot
Purity
Affinity purified
Synonyms
PSMA1, Antibody; PSMA1 Rabbit anti-Human Polyclonal Antibody; IHC-plus PSMA1 Antibody; PSMA1; 30 kDa prosomal protein; HC2; Macropain subunit C2; NU; PSC2; PROS30; Proteasome nu chain; Proteasome subunit alpha 1; Proteasome subunit nu; Protein P30-33K; Macropain subunit nu; PROS-30; Proteasome component C2; anti-PSMA1 antibody
Ordering
Host
Rabbit
Reactivity
Mouse, Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Human PSMA1
Purity/Purification
Affinity purified
Form/Format
PBS, pH7.3, 0.02% Sodium Azide, 50% Glycerol
Applicable Applications for anti-PSMA1 antibody
IF (Immunofluorescence), IHC (Immunohistochemistry), IHC (Immunohistochemistry), WB (Western Blot)
Application Notes
IF: 1:10-1:100
IHC: 1:50-1:200
IHC-P: 1:200
WB: 1:500-1:2000
The predicted MW is 29kDa/30kDa, while the observed MW by Western blot was 29kDa.
Target
Human PSMA1
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-263 of human PSMA1 (NP_002777.1). MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQKKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLEGLEERPQRKAQPAQPADEPAEKADEPMEH
Conjugation
Unconjugated
Family
Protease Non Catalytic
Subfamily
Threonine T1
Preparation and Storage
Store at -20 degree C. Avoid freeze-thaw cycles.

IHC (Immunohistochemistry)

(PSMA1 Antibody-Immunohistochemistry of paraffin-embedded mouse heart using PSMA1 antibody at dilution of 1:100 (400x lens).)

product-image-AAA21314_IHC7.jpg IHC (Immunohistochemistry) (PSMA1 Antibody-Immunohistochemistry of paraffin-embedded mouse heart using PSMA1 antibody at dilution of 1:100 (400x lens).)

IHC (Immunohistchemistry)

(PSMA1 Antibody-Immunohistochemistry of paraffin-embedded human breast cancer using PSMA1 antibody at dilution of 1:100 (400x lens).)

product-image-AAA21314_IHC6.jpg IHC (Immunohistchemistry) (PSMA1 Antibody-Immunohistochemistry of paraffin-embedded human breast cancer using PSMA1 antibody at dilution of 1:100 (400x lens).)

IHC (Immunohistochemistry)

(PSMA1 Antibody-Immunohistochemistry of paraffin-embedded human stomach cancer using PSMA1 antibody at dilution of 1:100 (400x lens).)

product-image-AAA21314_IHC5.jpg IHC (Immunohistochemistry) (PSMA1 Antibody-Immunohistochemistry of paraffin-embedded human stomach cancer using PSMA1 antibody at dilution of 1:100 (400x lens).)

IHC (Immunohistochemistry)

(PSMA1 Antibody-Immunohistochemistry of paraffin-embedded mouse lung tissue.)

product-image-AAA21314_IHC4.jpg IHC (Immunohistochemistry) (PSMA1 Antibody-Immunohistochemistry of paraffin-embedded mouse lung tissue.)

IHC (Immunohistochemistry)

(PSMA1 Antibody-Immunohistochemistry of paraffin-embedded rat lung using PSMA1 antibody at dilution of 1:100 (200x lens).)

product-image-AAA21314_IHC3.jpg IHC (Immunohistochemistry) (PSMA1 Antibody-Immunohistochemistry of paraffin-embedded rat lung using PSMA1 antibody at dilution of 1:100 (200x lens).)

IHC (Immunohistochemistry)

(PSMA1 Antibody-Human Breast: Formalin-Fixed, Paraffin-Embedded (FFPE))

product-image-AAA21314_IHC2.jpg IHC (Immunohistochemistry) (PSMA1 Antibody-Human Breast: Formalin-Fixed, Paraffin-Embedded (FFPE))

WB (Western Blot)

(PSMA1 Antibody-Western blot analysis of extracts of various cell lines, using PSMA1 antibody.)

product-image-AAA21314_WB.jpg WB (Western Blot) (PSMA1 Antibody-Western blot analysis of extracts of various cell lines, using PSMA1 antibody.)
Related Product Information for anti-PSMA1 antibody
PSMA1 antibody is an unconjugated rabbit polyclonal antibody to PSMA1 from human. It is reactive with human and mouse. Validated for IF, IHC and WB. Tested on 20 paraffin-embedded human tissues.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30,239 Da
NCBI Official Full Name
proteasome subunit alpha type-1 isoform 2
NCBI Official Synonym Full Names
proteasome (prosome, macropain) subunit, alpha type, 1
NCBI Official Symbol
PSMA1
NCBI Official Synonym Symbols
NU; HC2; PROS30; HEL-S-275
NCBI Protein Information
proteasome subunit alpha type-1; 30 kDa prosomal protein; PROS-30; epididymis secretory protein Li 275; macropain subunit C2; macropain subunit nu; multicatalytic endopeptidase complex subunit C2; proteasome component C2; proteasome nu chain; proteasome s
UniProt Protein Name
Proteasome subunit alpha type-1
UniProt Gene Name
PSMA1
UniProt Synonym Gene Names
HC2; NU; PROS30; PSC2; PROS-30
UniProt Entry Name
PSA1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The PSMA1 psma1 (Catalog #AAA21314) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PSMA1 Rabbit anti-Human Polyclonal Antibody reacts with Mouse, Human and may cross-react with other species as described in the data sheet. AAA Biotech's PSMA1 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), IHC (Immunohistochemistry), IHC (Immunohistochemistry), WB (Western Blot). IF: 1:10-1:100 IHC: 1:50-1:200 IHC-P: 1:200 WB: 1:500-1:2000 The predicted MW is 29kDa/30kDa, while the observed MW by Western blot was 29kDa. Researchers should empirically determine the suitability of the PSMA1 psma1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PSMA1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.