<
WB (Western Blot)
(WB Suggested Anti-PSMC6 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)
Rabbit PSMC6 Polyclonal Antibody | anti-PSMC6 antibody
PSMC6 antibody - C-terminal region
Gene Names
PSMC6; p42; SUG2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PSMC6, Antibody; PSMC6 antibody - C-terminal region; anti-PSMC6 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GFNGADLRNVCTEAGMFAIRADHDFVVQEDFMKAVRKVADSKKLESKLDY
Sequence Length
389
Applicable Applications for anti-PSMC6 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 86%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human PSMC6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-PSMC6 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)
WB (Western Blot)
(WB Suggested Anti-PSMC6 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)
WB (Western Blot)
(Lanes:1: 10ug proteasome fraction from C57B1/6J mouse brain, 2: 10ug proteasome fraction from BLAB/C mouse brainPrimary Antibody Dilution:1:500Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:5000Gene Name:PSMC6Submitted by:Dr. Scott Wilson, University of Alabama at Birmingham)
WB (Western Blot)
(Lanes:1: 10ug proteasome fraction from C57B1/6J mouse brain, 2: 10ug proteasome fraction from BLAB/C mouse brainPrimary Antibody Dilution:1:500Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:5000Gene Name:PSMC6Submitted by:Dr. Scott Wilson, University of Alabama at Birmingham)
WB (Western Blot)
(Host: RabbitTarget Name: PSMC6Sample Type: Human MCF7Antibody Dilution: 1.0ug/mlPSMC6 is supported by BioGPS gene expression data to be expressed in MCF7)
WB (Western Blot)
(Host: RabbitTarget Name: PSMC6Sample Type: Human MCF7Antibody Dilution: 1.0ug/mlPSMC6 is supported by BioGPS gene expression data to be expressed in MCF7)
WB (Western Blot)
(Host: RabbitTarget Name: PSMC6Sample Type: Human 721_BAntibody Dilution: 1.0ug/mlPSMC6 is supported by BioGPS gene expression data to be expressed in 721_B)
WB (Western Blot)
(Host: RabbitTarget Name: PSMC6Sample Type: Human 721_BAntibody Dilution: 1.0ug/mlPSMC6 is supported by BioGPS gene expression data to be expressed in 721_B)
Related Product Information for anti-PSMC6 antibody
This is a rabbit polyclonal antibody against PSMC6. It was validated on Western Blot
Target Description: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes one of the ATPase subunits, a member of the triple-A family of ATPases which have a chaperone-like activity. Pseudogenes have been identified on chromosomes 8 and 12.
Target Description: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes one of the ATPase subunits, a member of the triple-A family of ATPases which have a chaperone-like activity. Pseudogenes have been identified on chromosomes 8 and 12.
Product Categories/Family for anti-PSMC6 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
26S proteasome regulatory subunit 10B isoform 1
NCBI Official Synonym Full Names
proteasome 26S subunit, ATPase 6
NCBI Official Symbol
PSMC6
NCBI Official Synonym Symbols
p42; SUG2
NCBI Protein Information
26S proteasome regulatory subunit 10B
UniProt Protein Name
26S protease regulatory subunit 10B
UniProt Gene Name
PSMC6
UniProt Synonym Gene Names
SUG2
UniProt Entry Name
PRS10_HUMAN
Similar Products
Product Notes
The PSMC6 psmc6 (Catalog #AAA200929) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PSMC6 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PSMC6 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the PSMC6 psmc6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GFNGADLRNV CTEAGMFAIR ADHDFVVQED FMKAVRKVAD SKKLESKLDY. It is sometimes possible for the material contained within the vial of "PSMC6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.