Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201453_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: PTK2Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit PTK2 Polyclonal Antibody | anti-PTK2 antibody

PTK2 Antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
PTK2; FAK; FADK; FAK1; FRNK; PPP1R71; p125FAK; pp125FAK
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PTK2, Antibody; PTK2 Antibody - middle region; anti-PTK2 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SEKQGMRTHAVSVSETDDYAEIIDEEDTYTMPSTRDYEIQRER
IELGRC
Sequence Length
431
Applicable Applications for anti-PTK2 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human PTK2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: PTK2Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

product-image-AAA201453_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: PTK2Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: MouseTarget Name: PTK2Sample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)

product-image-AAA201453_WB13.jpg WB (Western Blot) (Host: MouseTarget Name: PTK2Sample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(Rabbit Anti-PTK2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Urinary Bladder TissueObserved Staining: Plasma membrane, CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA201453_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-PTK2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Urinary Bladder TissueObserved Staining: Plasma membrane, CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-PTK2 antibody
This is a rabbit polyclonal antibody against PTK2. It was validated on Western Blot

Target Description: This gene encodes a cytoplasmic protein tyrosine kinase which is found concentrated in the focal adhesions that form between cells growing in the presence of extracellular matrix constituents. The encoded protein is a member of the FAK subfamily of protein tyrosine kinases but lacks significant sequence similarity to kinases from other subfamilies. Activation of this gene may be an important early step in cell growth and intracellular signal transduction pathways triggered in response to certain neural peptides or to cell interactions with the extracellular matrix. Several transcript variants encoding different isoforms have been found for this gene, but the full-length natures of only three of them have been determined.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
focal adhesion kinase 1 isoform c
NCBI Official Synonym Full Names
protein tyrosine kinase 2
NCBI Official Symbol
PTK2
NCBI Official Synonym Symbols
FAK; FADK; FAK1; FRNK; PPP1R71; p125FAK; pp125FAK
NCBI Protein Information
focal adhesion kinase 1
UniProt Protein Name
Focal adhesion kinase 1
UniProt Gene Name
PTK2
UniProt Synonym Gene Names
FAK; FAK1; FADK 1; FRNK; PPP1R71
UniProt Entry Name
FAK1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The PTK2 ptk2 (Catalog #AAA201453) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PTK2 Antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PTK2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the PTK2 ptk2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SEKQGMRTHA VSVSETDDYA EIIDEEDTYT MPSTRDYEIQ RER
IE LGRC. It is sometimes possible for the material contained within the vial of "PTK2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.