WB (Western Blot)
(WB Suggested Anti-RAD17 Antibody Titration: 1 ug/mlPositive Control: Fetal liver cell lysate)
Rabbit RAD17 Polyclonal Antibody | anti-RAD17 antibody
RAD17 antibody - N-terminal region
Gene Names
RAD17; CCYC; R24L; RAD24; HRAD17; RAD17SP
Reactivity
Cow, Dog, Horse, Human, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RAD17, Antibody; RAD17 antibody - N-terminal region; anti-RAD17 antibody
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MNQVTDWVDPSFDDFLECSGVSTITATSLGVNNSSHRRKNGPSTLESSRF
Sequence Length
670
Applicable Applications for anti-RAD17 antibody
WB (Western Blot)
Homology
Cow: 89%; Dog: 100%; Horse: 92%; Human: 100%; Pig: 100%; Rabbit: 100%; Rat: 89%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human RAD17
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-RAD17 Antibody Titration: 1 ug/mlPositive Control: Fetal liver cell lysate)
WB (Western Blot)
(WB Suggested Anti-RAD17 Antibody Titration: 1 ug/mlPositive Control: Fetal liver cell lysate)
WB (Western Blot)
(WB Suggested Anti-RAD17 AntibodyPositive Control: Lane1: 25ug HeLa lysate, Lane2: 25ug Xenopus laevis egg extract, Lane3: 25ug mouse embryonic stem cell lysate, Lane4: 25ug HEK293T lysatePrimary Antibody Dilution : 1:500Secondary Antibody : Anti-rabbit-HRPSecondry Antibody Dilution : 1:3000Submitted by: Domenico Maiorano, Institute of Human Genetics, CNRS)
WB (Western Blot)
(WB Suggested Anti-RAD17 AntibodyPositive Control: Lane1: 25ug HeLa lysate, Lane2: 25ug Xenopus laevis egg extract, Lane3: 25ug mouse embryonic stem cell lysate, Lane4: 25ug HEK293T lysatePrimary Antibody Dilution : 1:500Secondary Antibody : Anti-rabbit-HRPSecondry Antibody Dilution : 1:3000Submitted by: Domenico Maiorano, Institute of Human Genetics, CNRS)
Related Product Information for anti-RAD17 antibody
This is a rabbit polyclonal antibody against RAD17. It was validated on Western Blot
Target Description: RAD17 is highly similar to the gene product of Schizosaccharomyces pombe rad17, a cell cycle checkpoint gene required for cell cycle arrest and DNA damage repair in response to DNA damage. This protein shares strong similarity with DNA replication factor C (RFC), and can form a complex with RFCs. This protein binds to chromatin prior to DNA damage and is phosphorylated by ATR after the damage. This protein recruits the RAD1-RAD9-HUS1 checkpoint protein complex onto chromatin after DNA damage, which may be required for its phosphorylation.
Target Description: RAD17 is highly similar to the gene product of Schizosaccharomyces pombe rad17, a cell cycle checkpoint gene required for cell cycle arrest and DNA damage repair in response to DNA damage. This protein shares strong similarity with DNA replication factor C (RFC), and can form a complex with RFCs. This protein binds to chromatin prior to DNA damage and is phosphorylated by ATR after the damage. This protein recruits the RAD1-RAD9-HUS1 checkpoint protein complex onto chromatin after DNA damage, which may be required for its phosphorylation.
Product Categories/Family for anti-RAD17 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
76kDa
NCBI Official Full Name
cell cycle checkpoint protein RAD17 isoform 1
NCBI Official Synonym Full Names
RAD17 checkpoint clamp loader component
NCBI Official Symbol
RAD17
NCBI Official Synonym Symbols
CCYC; R24L; RAD24; HRAD17; RAD17SP
NCBI Protein Information
cell cycle checkpoint protein RAD17
UniProt Protein Name
Cell cycle checkpoint protein RAD17
UniProt Gene Name
RAD17
UniProt Synonym Gene Names
R24L; hRad17
UniProt Entry Name
RAD17_HUMAN
Similar Products
Product Notes
The RAD17 rad17 (Catalog #AAA197106) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RAD17 antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RAD17 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the RAD17 rad17 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MNQVTDWVDP SFDDFLECSG VSTITATSLG VNNSSHRRKN GPSTLESSRF. It is sometimes possible for the material contained within the vial of "RAD17, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.