Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200771_WB13.jpg WB (Western Blot) (WB Suggested Anti-RB1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysateRB1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

Rabbit RB1 Polyclonal Antibody | anti-RB1 antibody

RB1 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
RB1; RB; pRb; OSRC; pp110; p105-Rb; PPP1R130
Reactivity
Cow, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RB1, Antibody; RB1 antibody - N-terminal region; anti-RB1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MPPKTPRKTAATAAAAAAEPPAPPPPPPPEEDPEQDSGPEDLPLVRLEFE
Sequence Length
928
Applicable Applications for anti-RB1 antibody
WB (Western Blot)
Homology
Cow: 93%; Human: 100%; Mouse: 80%; Pig: 93%; Rabbit: 93%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human RB1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-RB1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysateRB1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

product-image-AAA200771_WB13.jpg WB (Western Blot) (WB Suggested Anti-RB1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysateRB1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

WB (Western Blot)

(Researcher: Anke Rauch & Dr. Oliver Kramer, Institute for Biochemistry and Biophysics, Center for Molecular Biomedicine, Friedrich-Schiller University JenaApplication: Western blottingSpecies+tissue/cell type: Human Colon carcinoma cell line HCT116How many ug'sof tissue/cell lysate run on the gel:1. 30 ug HCT116 lysate (No stress)2. 30 ug HCT116 lysate(low stress)3. 30 ug HCT116 lysate(high stress)Primary antibody dilution: 1:2000Secondary antibody: Anti-rabbit HRPSecondary antibody dilution: 1:5000)

product-image-AAA200771_WB15.jpg WB (Western Blot) (Researcher: Anke Rauch & Dr. Oliver Kramer, Institute for Biochemistry and Biophysics, Center for Molecular Biomedicine, Friedrich-Schiller University JenaApplication: Western blottingSpecies+tissue/cell type: Human Colon carcinoma cell line HCT116How many ug'sof tissue/cell lysate run on the gel:1. 30 ug HCT116 lysate (No stress)2. 30 ug HCT116 lysate(low stress)3. 30 ug HCT116 lysate(high stress)Primary antibody dilution: 1:2000Secondary antibody: Anti-rabbit HRPSecondary antibody dilution: 1:5000)
Related Product Information for anti-RB1 antibody
This is a rabbit polyclonal antibody against RB1. It was validated on Western Blot

Target Description: The protein encoded by this gene is a negative regulator of the cell cycle and was the first tumor suppressor gene found. The encoded protein also stabilizes constitutive heterochromatin to maintain the overall chromatin structure. The active, hypophosphorylated form of the protein binds transcription factor E2F1. Defects in this gene are a cause of childhood cancer retinoblastoma (RB), bladder cancer, and osteogenic sarcoma.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
106kDa
NCBI Official Full Name
retinoblastoma-associated protein
NCBI Official Synonym Full Names
RB transcriptional corepressor 1
NCBI Official Symbol
RB1
NCBI Official Synonym Symbols
RB; pRb; OSRC; pp110; p105-Rb; PPP1R130
NCBI Protein Information
retinoblastoma-associated protein
UniProt Protein Name
Retinoblastoma-associated protein
UniProt Gene Name
RB1
UniProt Synonym Gene Names
Rb
UniProt Entry Name
RB_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The RB1 rb1 (Catalog #AAA200771) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RB1 antibody - N-terminal region reacts with Cow, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RB1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the RB1 rb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MPPKTPRKTA ATAAAAAAEP PAPPPPPPPE EDPEQDSGPE DLPLVRLEFE. It is sometimes possible for the material contained within the vial of "RB1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.