Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online
product-image-AAA11671_IHC8.jpg IHC (Immunohistochemistry) (Figure 8. IHC analysis of RbAp48 using anti-RbAp48 antibody (AAA11671).RbAp48 was detected in frozen section of rat small intestine tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-RbAp48 Antibody (AAA11671) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

RbAp48 Polyclonal Antibody | anti-RbAp48 antibody

Anti-RbAp48 Antibody

Gene Names
RBBP4; NURF55; RBAP48; lin-53
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Immunogen Affinity Purified
Synonyms
RbAp48, Antibody; Anti-RbAp48 Antibody; Histone-binding protein RBBP4; CAF I p48; CAF-1 subunit C; CAF-I 48 kDa subunit; CAF-I p48; Chromatin assembly factor 1 subunit C; Chromatin assembly factor I p48 subunit; Chromatin assembly factor/CAF 1 p48 subunit; MSI1 protein homolog; Nucleosome-remodeling factor subunit RBAP48; NURF55; RbAp 48; RBAP48; RBBP-4; RBBP4; RBBP4_HUMAN; Retinoblastoma binding protein 4; Retinoblastoma binding protein p48; Retinoblastoma-binding protein 4; Retinoblastoma-binding protein p48; retinoblastoma binding protein 4; anti-RbAp48 antibody
Ordering
For Research Use Only!
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
424
Applicable Applications for anti-RbAp48 antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Application Notes
Western Blot Concentration: 0.1-0.5ug/ml
Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human RbAp48 (395-425aa EDNIMQVWQMAENIYNDEDPEGSVDPEGQGS), identical to the related mouse sequence.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistochemistry)

(Figure 8. IHC analysis of RbAp48 using anti-RbAp48 antibody (AAA11671).RbAp48 was detected in frozen section of rat small intestine tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-RbAp48 Antibody (AAA11671) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

product-image-AAA11671_IHC8.jpg IHC (Immunohistochemistry) (Figure 8. IHC analysis of RbAp48 using anti-RbAp48 antibody (AAA11671).RbAp48 was detected in frozen section of rat small intestine tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-RbAp48 Antibody (AAA11671) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

IHC (Immunohistochemistry)

(Figure 7. IHC analysis of RbAp48 using anti-RbAp48 antibody (AAA11671).RbAp48 was detected in frozen section of mouse small intestine tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-RbAp48 Antibody (AAA11671) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

product-image-AAA11671_IHC7.jpg IHC (Immunohistochemistry) (Figure 7. IHC analysis of RbAp48 using anti-RbAp48 antibody (AAA11671).RbAp48 was detected in frozen section of mouse small intestine tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-RbAp48 Antibody (AAA11671) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

IHC (Immunohistchemistry)

(Figure 6. IHC analysis of RbAp48 using anti-RbAp48 antibody (AAA11671).RbAp48 was detected in frozen section of mouse liver tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-RbAp48 Antibody (AAA11671) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

product-image-AAA11671_IHC6.jpg IHC (Immunohistchemistry) (Figure 6. IHC analysis of RbAp48 using anti-RbAp48 antibody (AAA11671).RbAp48 was detected in frozen section of mouse liver tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-RbAp48 Antibody (AAA11671) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

IHC (Immunohistochemistry)

(Figure 5. IHC analysis of RbAp48 using anti-RbAp48 antibody (AAA11671).RbAp48 was detected in frozen section of human placenta tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-RbAp48 Antibody (AAA11671) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

product-image-AAA11671_IHC5.jpg IHC (Immunohistochemistry) (Figure 5. IHC analysis of RbAp48 using anti-RbAp48 antibody (AAA11671).RbAp48 was detected in frozen section of human placenta tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-RbAp48 Antibody (AAA11671) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

IHC (Immunohistochemistry)

(Figure 4. IHC analysis of RbAp48 using anti-RbAp48 antibody (AAA11671).RbAp48 was detected in paraffin-embedded section of Human Intestinal Cancer Tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-RbAp48 Antibody (AAA11671) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

product-image-AAA11671_IHC4.jpg IHC (Immunohistochemistry) (Figure 4. IHC analysis of RbAp48 using anti-RbAp48 antibody (AAA11671).RbAp48 was detected in paraffin-embedded section of Human Intestinal Cancer Tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-RbAp48 Antibody (AAA11671) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

IHC (Immunohistochemistry)

(Figure 3. IHC analysis of RbAp48 using anti-RbAp48 antibody (AAA11671).RbAp48 was detected in paraffin-embedded section of Rat Intestine Tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-RbAp48 Antibody (AAA11671) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

product-image-AAA11671_IHC3.jpg IHC (Immunohistochemistry) (Figure 3. IHC analysis of RbAp48 using anti-RbAp48 antibody (AAA11671).RbAp48 was detected in paraffin-embedded section of Rat Intestine Tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-RbAp48 Antibody (AAA11671) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

IHC (Immunohistochemistry)

(Figure 2. IHC analysis of RbAp48 using anti-RbAp48 antibody (AAA11671).RbAp48 was detected in paraffin-embedded section of Mouse Liver Tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-RbAp48 Antibody (AAA11671) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

product-image-AAA11671_IHC2.jpg IHC (Immunohistochemistry) (Figure 2. IHC analysis of RbAp48 using anti-RbAp48 antibody (AAA11671).RbAp48 was detected in paraffin-embedded section of Mouse Liver Tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-RbAp48 Antibody (AAA11671) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

WB (Western Blot)

(Figure 1. Western blot analysis of RbAp48 using anti-RbAp48 antibody (AAA11671).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: Rat Brain Tissue Lysate,Lane 2: Mouse Liver Tissue Lysate,Lane 3: Mouse Lung Tissue Lysate,Lane 4: HELA Whole Cell Lysate,Lane 5: JURKAT Whole Cell Lysate.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-RbAp48 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for RbAp48 at approximately 54KD. The expected band size for RbAp48 is at 54KD.)

product-image-AAA11671_WB.jpg WB (Western Blot) (Figure 1. Western blot analysis of RbAp48 using anti-RbAp48 antibody (AAA11671).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: Rat Brain Tissue Lysate,Lane 2: Mouse Liver Tissue Lysate,Lane 3: Mouse Lung Tissue Lysate,Lane 4: HELA Whole Cell Lysate,Lane 5: JURKAT Whole Cell Lysate.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-RbAp48 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for RbAp48 at approximately 54KD. The expected band size for RbAp48 is at 54KD.)
Related Product Information for anti-RbAp48 antibody
Description: Rabbit IgG polyclonal antibody for Histone-binding protein RBBP4(RBBP4) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: Histone-binding protein RBBP4 (also known as RbAp48, or NURF55) is a protein that in humans is encoded by the RBBP4 gene. This gene encodes a ubiquitously expressed nuclear protein which belongs to a highly conserved subfamily of WD-repeat proteins. It is present in protein complexes involved in histone acetylation and chromatin assembly. And it is part of the Mi-2 complex which has been implicated in chromatin remodeling and transcriptional repression associated with histone deacetylation. This encoded protein is also part of co-repressor complexes, which is an integral component of transcriptional silencing. It is found among several cellular proteins that bind directly to retinoblastoma protein to regulate cell proliferation. This protein also seems to be involved in transcriptional repression of E2F-responsive genes. Three transcript variants encoding different isoforms have been found for this gene.
References
1. "Entrez Gene: RBBP4 retinoblastoma-binding protein 4". 2. Barak O, Lazzaro MA, Lane WS, Speicher DW, Picketts DJ, Shiekhattar R (November 2003). "Isolation of human NURF: a regulator of Engrailed gene expression". EMBO J 22 (22): 6089-100. 3. Qian YW, Wang YC, Hollingsworth RE Jr, Jones D, Ling N, Lee EY (September 1993). "A retinoblastoma-binding protein related to a negative regulator of Ras in yeast". Nature 364 (6438): 648-52.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43,482 Da
NCBI Official Full Name
histone-binding protein RBBP4 isoform b
NCBI Official Synonym Full Names
retinoblastoma binding protein 4
NCBI Official Symbol
RBBP4
NCBI Official Synonym Symbols
NURF55; RBAP48; lin-53
NCBI Protein Information
histone-binding protein RBBP4
UniProt Protein Name
Histone-binding protein RBBP4
UniProt Gene Name
RBBP4
UniProt Synonym Gene Names
RBAP48; CAF-1 subunit C; CAF-I 48 kDa subunit; CAF-I p48; RBBP-4
UniProt Entry Name
RBBP4_HUMAN

Similar Products

Product Notes

The RbAp48 rbbp4 (Catalog #AAA11671) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-RbAp48 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RbAp48 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC) Paraffin. Western Blot Concentration: 0.1-0.5ug/ml Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml. Researchers should empirically determine the suitability of the RbAp48 rbbp4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RbAp48, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.