Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201743_WB13.jpg WB (Western Blot) (WB Suggested Anti-RFX1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysate)

Rabbit RFX1 Polyclonal Antibody | anti-RFX1 antibody

RFX1 antibody - C-terminal region

Gene Names
RFX1; EFC; RFX
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RFX1, Antibody; RFX1 antibody - C-terminal region; anti-RFX1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ESEDELPQDISLAAGGESPALGPETLEPPAKLARTDARGLFVQALPSS
Sequence Length
979
Applicable Applications for anti-RFX1 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 92%; Pig: 92%; Rat: 92%; Zebrafish: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human RFX1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-RFX1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysate)

product-image-AAA201743_WB13.jpg WB (Western Blot) (WB Suggested Anti-RFX1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysate)

WB (Western Blot)

(Host: MouseTarget Name: RFX1Sample Tissue: Mouse PancreasAntibody Dilution: 1ug/ml)

product-image-AAA201743_WB15.jpg WB (Western Blot) (Host: MouseTarget Name: RFX1Sample Tissue: Mouse PancreasAntibody Dilution: 1ug/ml)
Related Product Information for anti-RFX1 antibody
This is a rabbit polyclonal antibody against RFX1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: RFX1 is a member of the regulatory factor X protein family, which are transcription factors that contain a highly-conserved winged helix DNA binding domain. RFX1 is structurally related to regulatory factors X2, X3, X4, and X5. It is a transcriptional activator that can bind DNA as a monomer or as a heterodimer with RFX family members X2, X3, and X5, but not with X4. This protein binds to the X-boxes of MHC class II genes and is essential for their expression. Also, it can bind to an inverted repeat that is required for expression of hepatitis B virus genes.This gene is a member of the regulatory factor X gene family, which encodes transcription factors that contain a highly-conserved winged helix DNA binding domain. The protein encoded by this gene is structurally related to regulatory factors X2, X3, X4, and X5. It is a transcriptional activator that can bind DNA as a monomer or as a heterodimer with RFX family members X2, X3, and X5, but not with X4. This protein binds to the X-boxes of MHC class II genes and is essential for their expression. Also, it can bind to an inverted repeat that is required for expression of hepatitis B virus genes. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
105kDa
NCBI Official Full Name
MHC class II regulatory factor RFX1
NCBI Official Synonym Full Names
regulatory factor X1
NCBI Official Symbol
RFX1
NCBI Official Synonym Symbols
EFC; RFX
NCBI Protein Information
MHC class II regulatory factor RFX1
UniProt Protein Name
MHC class II regulatory factor RFX1
UniProt Gene Name
RFX1
UniProt Synonym Gene Names
EF-C; RFX
UniProt Entry Name
RFX1_HUMAN

Similar Products

Product Notes

The RFX1 rfx1 (Catalog #AAA201743) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RFX1 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's RFX1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the RFX1 rfx1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ESEDELPQDI SLAAGGESPA LGPETLEPPA KLARTDARGL FVQALPSS. It is sometimes possible for the material contained within the vial of "RFX1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.