Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46551_FCM13.jpg FCM/FACS (Flow Cytometry) (Figure 2. Flow Cytometry analysis of BRL cells using anti-SCARB1 antibody (AAA46551).Overlay histogram showing BRL cells stained with AAA46551 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-SCARB1 Antibody (AAA46551,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

anti-Mouse, Rat SCARB1 Polyclonal Antibody | anti-SCARB1 antibody

Anti-SCARB1 Antibody

Average rating 0.0
No ratings yet
Gene Names
Scarb1; CD36; Cla1; SRBI; Srb1; Cla-1; Hdlq1; SR-B1; SR-BI; Cd36l1; Chohd1; Hlb398; mSR-BI; AI120173; D5Ertd460e
Reactivity
Mouse, Rat
Applications
Western Blot
Purity
Immunogen Affinity Purified
Synonyms
SCARB1, Antibody; Anti-SCARB1 Antibody; Scavenger receptor class B member 1; CD36 AND LIMPII ANALOGOUS 1; CD36; CD36 Antigen like 1; CD36 antigen-like 1; CD36L1; CLA 1; CLA-1; CLA1; Collagen type I receptor; HDLQTL6; MGC138242; SCARB1; Scavebger Receptor Class B Member 1; Scavenger Receptor Class B Type 1; SCRB1_HUMAN; SR BI; SR-BI; SRB1; SRBI; Thrombospondin receptor like 1; thrombospondin receptor-like 1; scavenger receptor class B, member 1; anti-SCARB1 antibody
Ordering
Reactivity
Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
506
Applicable Applications for anti-SCARB1 antibody
WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of mouse SCARB1 (478-509aa KKGSQDKEAIQAYSESLMSPAAKGTVLQEAKL), different from the related rat sequence by one amino acid.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

FCM/FACS (Flow Cytometry)

(Figure 2. Flow Cytometry analysis of BRL cells using anti-SCARB1 antibody (AAA46551).Overlay histogram showing BRL cells stained with AAA46551 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-SCARB1 Antibody (AAA46551,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

product-image-AAA46551_FCM13.jpg FCM/FACS (Flow Cytometry) (Figure 2. Flow Cytometry analysis of BRL cells using anti-SCARB1 antibody (AAA46551).Overlay histogram showing BRL cells stained with AAA46551 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-SCARB1 Antibody (AAA46551,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

WB (Western Blot)

(Figure 1. Western blot analysis of SCARB1 using anti-SCARB1 antibody (AAA46551).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: Rat Testis Tissue Lysate,Lane 2: Mouse Testis Tissue Lysate.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-SCARB1 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for SCARB1 at approximately 57KD. The expected band size for SCARB1 is at 57KD.)

product-image-AAA46551_WB15.jpg WB (Western Blot) (Figure 1. Western blot analysis of SCARB1 using anti-SCARB1 antibody (AAA46551).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: Rat Testis Tissue Lysate,Lane 2: Mouse Testis Tissue Lysate.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-SCARB1 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for SCARB1 at approximately 57KD. The expected band size for SCARB1 is at 57KD.)
Related Product Information for anti-SCARB1 antibody
Description: Rabbit IgG polyclonal antibody for Scavenger receptor class B member 1(SCARB1) detection. Tested with WB in Mouse;Rat.

Background: Scavenger receptor class B member 1 (SRB1), also known as SR-BI, is a protein that in humans is encoded by the SCARB1 gene. SR-BI functions as a receptor for high-density lipoprotein. Scavenger receptor class B, type I (SR-BI) is an integral membrane protein found in numerous cell types/tissues, including the liver and adrenal. It is best known for its role in facilitating the uptake of cholesteryl esters from high-density lipoproteins in the liver. This process drives the movement of cholesterol from peripheral tissues towards the liver for excretion. This movement of cholesterol is known as reverse cholesterol transport and is a protective mechanism against the development of atherosclerosis, which is the principal cause of heart disease and stroke. SR-BI has also been identified in the livers of non-mammalian species (turtle, goldfish, shark, chicken, frog, and skate), suggesting it emerged early in vertebrate evolutionary history. The turtle also seems to upregulate SB-RI during egg development, indicating that cholesterol efflux may be at peak levels during developmental stages.
References
1. "Entrez Gene: SCARB1 Scavenger receptor class B, member 1". 2. Acton S, Rigotti A, Landschulz KT, Xu S, Hobbs HH, Krieger M (January 1996). "Identification of scavenger receptor SR-BI as a high density lipoprotein receptor".Science 271 (5248): 518-20. 3. Duggan AE, Marie RS, Callard IP (April 2002). "Expression of SR-BI (Scavenger Receptor Class B Type I) in turtle (Chrysemys picta) tissues and other nonmammalian vertebrates". J. Exp. Zool.292 (5): 430-4.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56,754 Da
NCBI Official Full Name
scavenger receptor class B member 1 isoform 2
NCBI Official Synonym Full Names
scavenger receptor class B, member 1
NCBI Official Symbol
Scarb1
NCBI Official Synonym Symbols
CD36; Cla1; SRBI; Srb1; Cla-1; Hdlq1; SR-B1; SR-BI; Cd36l1; Chohd1; Hlb398; mSR-BI; AI120173; D5Ertd460e
NCBI Protein Information
scavenger receptor class B member 1
UniProt Protein Name
Scavenger receptor class B member 1
UniProt Gene Name
Scarb1
UniProt Synonym Gene Names
Srb1; SRB1
UniProt Entry Name
SCRB1_MOUSE

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The SCARB1 scarb1 (Catalog #AAA46551) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-SCARB1 Antibody reacts with Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SCARB1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the SCARB1 scarb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SCARB1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.