WB (Western Blot)
(WB Suggested Anti-SERPINA1 Antibody Titration: 1.25ug/mlELISA Titer: 1:12500Positive Control: HepG2 cell lysateSERPINA1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)
Rabbit anti-Human SERPINA1 Polyclonal Antibody | anti-SERPINA1 antibody
SERPINA1 antibody - C-terminal region
Gene Names
SERPINA1; PI; A1A; AAT; PI1; A1AT; nNIF; PRO2275; alpha1AT
Reactivity
Human
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
SERPINA1, Antibody; SERPINA1 antibody - C-terminal region; anti-SERPINA1 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK
Sequence Length
418
Applicable Applications for anti-SERPINA1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human SERPINA1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-SERPINA1 Antibody Titration: 1.25ug/mlELISA Titer: 1:12500Positive Control: HepG2 cell lysateSERPINA1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)
WB (Western Blot)
(WB Suggested Anti-SERPINA1 Antibody Titration: 1.25ug/mlELISA Titer: 1:12500Positive Control: HepG2 cell lysateSERPINA1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)
IHC (Immunohistochemistry)
(WB Suggested Anti-SERPINA1 Antibody Titration: 4.0-8.0Positive Control: Human kidney lysate)
IHC (Immunohistochemistry)
(WB Suggested Anti-SERPINA1 Antibody Titration: 4.0-8.0Positive Control: Human kidney lysate)
Related Product Information for anti-SERPINA1 antibody
This is a rabbit polyclonal antibody against SERPINA1. It was validated on Western Blot and immunohistochemistry
Target Description: Alpha-1-antitrypsin is a protease inhibitor, deficiency of which is associated with emphysema and liver disease. The protein is encoded by a gene (PI) located on the distal long arm of chromosome 14.
Target Description: Alpha-1-antitrypsin is a protease inhibitor, deficiency of which is associated with emphysema and liver disease. The protein is encoded by a gene (PI) located on the distal long arm of chromosome 14.
Product Categories/Family for anti-SERPINA1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46kDa
NCBI Official Full Name
alpha-1-antitrypsin
NCBI Official Synonym Full Names
serpin family A member 1
NCBI Official Symbol
SERPINA1
NCBI Official Synonym Symbols
PI; A1A; AAT; PI1; A1AT; nNIF; PRO2275; alpha1AT
NCBI Protein Information
alpha-1-antitrypsin
UniProt Protein Name
Alpha-1-antitrypsin
UniProt Gene Name
SERPINA1
UniProt Synonym Gene Names
AAT; PI; SPAAT
UniProt Entry Name
A1AT_HUMAN
Similar Products
Product Notes
The SERPINA1 serpina1 (Catalog #AAA201648) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SERPINA1 antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SERPINA1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the SERPINA1 serpina1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TEAAGAMFLE AIPMSIPPEV KFNKPFVFLM IEQNTKSPLF MGKVVNPTQK. It is sometimes possible for the material contained within the vial of "SERPINA1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.