<
WB (Western Blot)
(WB Suggested Anti-SERPINE1 Antibody Titration: 0.2-1 ug/mlPositive Control: Transfected 293T)
Rabbit SERPINE1 Polyclonal Antibody | anti-SERPINE1 antibody
SERPINE1 antibody - N-terminal region
Gene Names
SERPINE1; PAI; PAI1; PAI-1; PLANH1
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
SERPINE1, Antibody; SERPINE1 antibody - N-terminal region; anti-SERPINE1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VAHLASDFGVRVFQQVAQASKDRNVVFSPYGVASVLAMLQLTTGGETQQQ
Sequence Length
402
Applicable Applications for anti-SERPINE1 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 100%; Dog: 93%; Horse: 86%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SERPINE1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-SERPINE1 Antibody Titration: 0.2-1 ug/mlPositive Control: Transfected 293T)
WB (Western Blot)
(WB Suggested Anti-SERPINE1 Antibody Titration: 0.2-1 ug/mlPositive Control: Transfected 293T)
WB (Western Blot)
(Host: RabbitTarget Name: SERPINE1Sample Tissue: Mouse Skeletal MuscleAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: SERPINE1Sample Tissue: Mouse Skeletal MuscleAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: MouseTarget Name: SERPINE1Sample Tissue: Mouse Skeletal MuscleAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: MouseTarget Name: SERPINE1Sample Tissue: Mouse Skeletal MuscleAntibody Dilution: 1ug/ml)
IHC (Immunohistochemistry)
(SERPINE1 antibody - N-terminal regionFormalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial TissueObserved Staining: Cytoplasm in Human Bronchial Epithelial TissuePrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
IHC (Immunohistochemistry)
(SERPINE1 antibody - N-terminal regionFormalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial TissueObserved Staining: Cytoplasm in Human Bronchial Epithelial TissuePrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-SERPINE1 antibody
This is a rabbit polyclonal antibody against SERPINE1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: SERPINE1 acts as 'bait' for tissue plasminogen activator, urokinase, and protein C. Its rapid interaction with TPA may function as a major control point in the regulation of fibrinolysis.
Target Description: SERPINE1 acts as 'bait' for tissue plasminogen activator, urokinase, and protein C. Its rapid interaction with TPA may function as a major control point in the regulation of fibrinolysis.
Product Categories/Family for anti-SERPINE1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
plasminogen activator inhibitor 1
NCBI Official Synonym Full Names
serpin family E member 1
NCBI Official Symbol
SERPINE1
NCBI Official Synonym Symbols
PAI; PAI1; PAI-1; PLANH1
NCBI Protein Information
plasminogen activator inhibitor 1
UniProt Protein Name
Plasminogen activator inhibitor 1
UniProt Gene Name
SERPINE1
UniProt Synonym Gene Names
PAI1; PLANH1; PAI; PAI-1
UniProt Entry Name
PAI1_HUMAN
Similar Products
Product Notes
The SERPINE1 serpine1 (Catalog #AAA199809) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SERPINE1 antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's SERPINE1 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the SERPINE1 serpine1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VAHLASDFGV RVFQQVAQAS KDRNVVFSPY GVASVLAMLQ LTTGGETQQQ. It is sometimes possible for the material contained within the vial of "SERPINE1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.