Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201548_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: SHC1Sample Tissue: Human Jurkat Whole CellAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human SHC1 Polyclonal Antibody | anti-SHC1 antibody

SHC1 Antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
SHC1; SHC; SHCA
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
SHC1, Antibody; SHC1 Antibody - middle region; anti-SHC1 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EPPDHQYYNDFPGKEPPLGGVVDMRLREGAAPGAARPTAPNAQTPSHLGA
Sequence Length
167
Applicable Applications for anti-SHC1 antibody
WB (Western Blot)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SHC1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: SHC1Sample Tissue: Human Jurkat Whole CellAntibody Dilution: 1.0ug/ml)

product-image-AAA201548_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: SHC1Sample Tissue: Human Jurkat Whole CellAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: MouseTarget Name: SHC1Sample Tissue: Mouse SpleenAntibody Dilution: 1ug/ml)

product-image-AAA201548_WB15.jpg WB (Western Blot) (Host: MouseTarget Name: SHC1Sample Tissue: Mouse SpleenAntibody Dilution: 1ug/ml)
Related Product Information for anti-SHC1 antibody
This gene encodes three main isoforms that differ in activities and subcellular location. While all three are adapter proteins in signal transduction pathways, the longest (p66Shc) may be involved in regulating life span and the effects of reactive oxygen species. The other two isoforms, p52Shc and p46Shc, link activated receptor tyrosine kinases to the Ras pathway by recruitment of the GRB2/SOS complex. p66Shc is not involved in Ras activation. Unlike the other two isoforms, p46Shc is targeted to the mitochondrial matrix. Several transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-SHC1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
63 kDa
NCBI Official Full Name
SHC-transforming protein 1 isoform 3
NCBI Official Synonym Full Names
SHC adaptor protein 1
NCBI Official Symbol
SHC1
NCBI Official Synonym Symbols
SHC; SHCA
NCBI Protein Information
SHC-transforming protein 1
UniProt Protein Name
SHC-transforming protein 1
UniProt Gene Name
SHC1
UniProt Synonym Gene Names
SHC; SHCA; SH2 domain protein C1
UniProt Entry Name
SHC1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The SHC1 shc1 (Catalog #AAA201548) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SHC1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SHC1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the SHC1 shc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EPPDHQYYND FPGKEPPLGG VVDMRLREGA APGAARPTAP NAQTPSHLGA. It is sometimes possible for the material contained within the vial of "SHC1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.