WB (Western Blot)
(WB Suggested Anti-SILV Antibody Titration: 1.25ug/mlPositive Control: HepG2 cell lysate)
Rabbit SILV Polyclonal Antibody | anti-PMEL antibody
SILV antibody - N-terminal region
Gene Names
PMEL; P1; SI; SIL; ME20; P100; SILV; ME20M; gp100; ME20-M; PMEL17; D12S53E
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
SILV, Antibody; SILV antibody - N-terminal region; anti-PMEL antibody
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HFLRNQPLTFALQLHDPSGYLAEADLSYTWDFGDSSGTLISRALVVTHTY
Sequence Length
661
Applicable Applications for anti-PMEL antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 93%; Dog: 86%; Goat: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SILV
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-SILV Antibody Titration: 1.25ug/mlPositive Control: HepG2 cell lysate)
WB (Western Blot)
(WB Suggested Anti-SILV Antibody Titration: 1.25ug/mlPositive Control: HepG2 cell lysate)
WB (Western Blot)
(Host: RabbitTarget Name: SILVSample Tissue: Human MCF7Antibody Dilution: 1.0ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: SILVSample Tissue: Human MCF7Antibody Dilution: 1.0ug/ml)
IHC (Immunohistochemistry)
(Human kidney)
IHC (Immunohistochemistry)
(Human kidney)
Related Product Information for anti-PMEL antibody
This is a rabbit polyclonal antibody against SILV. It was validated on Western Blot and immunohistochemistry
Target Description: SILV could be a melanogenic enzyme. It could represent an oncofetal self-antigen that is normally expressed at low levels in quiescent adult melanocytes but overexpressed by proliferating neonatal melanocytes and during tumor growth. Release of the soluble form, ME20-S, it could protect tumor cells from antibody mediated immunity.
Target Description: SILV could be a melanogenic enzyme. It could represent an oncofetal self-antigen that is normally expressed at low levels in quiescent adult melanocytes but overexpressed by proliferating neonatal melanocytes and during tumor growth. Release of the soluble form, ME20-S, it could protect tumor cells from antibody mediated immunity.
Product Categories/Family for anti-PMEL antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
70kDa
NCBI Official Full Name
melanocyte protein PMEL isoform 3 preproprotein
NCBI Official Synonym Full Names
premelanosome protein
NCBI Official Symbol
PMEL
NCBI Official Synonym Symbols
P1; SI; SIL; ME20; P100; SILV; ME20M; gp100; ME20-M; PMEL17; D12S53E
NCBI Protein Information
melanocyte protein PMEL
UniProt Protein Name
Melanocyte protein PMEL
UniProt Gene Name
PMEL
UniProt Synonym Gene Names
D12S53E; PMEL17; SILV; ME20M; ME20-S; ME20S
UniProt Entry Name
PMEL_HUMAN
Similar Products
Product Notes
The PMEL pmel (Catalog #AAA199750) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SILV antibody - N-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SILV can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the PMEL pmel for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HFLRNQPLTF ALQLHDPSGY LAEADLSYTW DFGDSSGTLI SRALVVTHTY. It is sometimes possible for the material contained within the vial of "SILV, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.