Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281168_IHC10.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human liver cancer using SIN3A antibody at dilution of 1:100 (40x lens).)

Rabbit anti-Human, Rat SIN3A Polyclonal Antibody | anti-SIN3A antibody

SIN3A Polyclonal Antibody

Gene Names
SIN3A; WITKOS
Reactivity
Human, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purification
Synonyms
SIN3A, Antibody; SIN3A Polyclonal Antibody; WITKOS; anti-SIN3A antibody
Ordering
Host
Rabbit
Reactivity
Human, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
MKRRLDDQESPVYAAQQRRIPGSTEAFPHQHRVLAPAPPVYEAVSETMQSATGIQYSVTPSYQVSAMPQSSGSHGPAIAAVHSSHHHPTAVQPHGGQVVQSHAHPAPPVAPVQGQQQFQR
Sequence Length
1273
Applicable Applications for anti-SIN3A antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
Recombinant protein of human SIN3A
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Nucleus, nucleolus
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human liver cancer using SIN3A antibody at dilution of 1:100 (40x lens).)

product-image-AAA281168_IHC10.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human liver cancer using SIN3A antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemisry)

(Immunohistochemistry of paraffin-embedded human lung cancer using SIN3A antibody at dilution of 1:100 (40x lens).)

product-image-AAA281168_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry of paraffin-embedded human lung cancer using SIN3A antibody at dilution of 1:100 (40x lens).)

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded rat liver using SIN3A antibody at dilution of 1:100 (40x lens).)

product-image-AAA281168_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded rat liver using SIN3A antibody at dilution of 1:100 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of 293T cells, using SIN3A antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.)

product-image-AAA281168_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of 293T cells, using SIN3A antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.)
Related Product Information for anti-SIN3A antibody
The protein encoded by this gene is a transcriptional regulatory protein. It contains paired amphipathic helix (PAH) domains, which are important for protein-protein interactions and may mediate repression by the Mad-Max complex.
Product Categories/Family for anti-SIN3A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 145kDa
Observed: 147kDa
NCBI Official Full Name
paired amphipathic helix protein Sin3a
NCBI Official Synonym Full Names
SIN3 transcription regulator family member A
NCBI Official Symbol
SIN3A
NCBI Official Synonym Symbols
WITKOS
NCBI Protein Information
paired amphipathic helix protein Sin3a
UniProt Protein Name
Paired amphipathic helix protein Sin3a
UniProt Gene Name
SIN3A

Similar Products

Product Notes

The SIN3A sin3a (Catalog #AAA281168) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SIN3A Polyclonal Antibody reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SIN3A can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the SIN3A sin3a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MKRRLDDQES PVYAAQQRRI PGSTEAFPHQ HRVLAPAPPV YEAVSETMQS ATGIQYSVTP SYQVSAMPQS SGSHGPAIAA VHSSHHHPTA VQPHGGQVVQ SHAHPAPPVA PVQGQQQFQR. It is sometimes possible for the material contained within the vial of "SIN3A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.