Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA125486_WB11.jpg WB (Western Blot)

Rabbit anti-Human SKA2 Polyclonal Antibody | anti-SKA2 antibody

Anti-SKA2 Antibody

Average rating 0.0
No ratings yet
Gene Names
SKA2; FAM33A
Reactivity
Human
Applications
Flow Cytometry, Functional Assay, Western Blot
Purity
Immunogen affinity purified.
Synonyms
SKA2, Antibody; Anti-SKA2 Antibody; Spindle and kinetochore-associated protein 2; Protein FAM33A; SKA2; FAM33A ; anti-SKA2 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
No cross reactivity with other proteins.
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
121
Applicable Applications for anti-SKA2 antibody
FCM/FACS (Flow Cytometry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence of human SKA2 (EAEVDKLELMFQKAESDLDYIQYRLEYEIK).
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen store at -20 degree C for a longer time. Avoid repeated freezing and thawing.

WB (Western Blot)

product-image-AAA125486_WB11.jpg WB (Western Blot)

FCM/FACS (Flow Cytometry)

product-image-AAA125486_FCM13.png FCM/FACS (Flow Cytometry)

FCM/FACS (Flow Cytometry)

product-image-AAA125486_FCM15.png FCM/FACS (Flow Cytometry)
Related Product Information for anti-SKA2 antibody
Description: Rabbit IgG polyclonal antibody for SKA2 detection. Tested with WB, FCM in Human.

Background: Spindle and kinetochore-associated protein 2 is a protein that in humans is encoded by the SKA2 gene found in chromosome 17.SKA2 is a part of a spindle and kinetochore associated complex also including SKA1 and SKA3 which is responsible for onset of the anaphase in mitosis by regulating chromosomal segregation. SKA2 may function as a prognostic gene marker for identifying lung cancer[3] as well as a proposed biomarker for suicidal tendencies and post-traumatic stress disorders.[4][5] The SKA2 gene contains one single-nucleotide polymorphism (SNP) rs7208505 located in the 3' UTR. This genetic variant containing a cytosine (existing in the less common allele) instead of thymine along with epigenetic modification (such as DNA methylation) is correlated with suicidal tendencies and post-traumatic stress
References
1. Hanisch A, Silljé HH, Nigg EA (November 2006). "Timely anaphase onset requires a novel spindle and kinetochore complex comprising Ska1 and Ska2". The EMBO Journal. 25 (23): 5504-15.
2. Wang Y, Zhang Y, Zhang C, Weng H, Li Y, Cai W, Xie M, Long Y, Ai Q, Liu Z, Du G, Wang S, Niu Y, Song F, Ozaki T, Bu Y (September 2015). "The gene pair PRR11 and SKA2 shares a NF-Y-regulated bidirectional promoter and contributes to lung cancer development". Biochimica et Biophysica Acta. 1849 (9): 1133-44.
3. Guintivano J, Brown T, Newcomer A, Jones M, Cox O, Maher BS, Eaton WW, Payne JL, Wilcox HC, Kaminsky ZA (December 2014). "Identification and replication of a combined epigenetic and genetic biomarker predicting suicide and suicidal behaviors". The American Journal of Psychiatry. 171 (12): 1287-96.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
spindle and kinetochore-associated protein 2 isoform 1
NCBI Official Synonym Full Names
spindle and kinetochore associated complex subunit 2
NCBI Official Symbol
SKA2
NCBI Official Synonym Symbols
FAM33A
NCBI Protein Information
spindle and kinetochore-associated protein 2
UniProt Protein Name
Spindle and kinetochore-associated protein 2
UniProt Gene Name
SKA2
UniProt Synonym Gene Names
FAM33A
UniProt Entry Name
SKA2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The SKA2 ska2 (Catalog #AAA125486) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-SKA2 Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SKA2 can be used in a range of immunoassay formats including, but not limited to, FCM/FACS (Flow Cytometry), WB (Western Blot). Researchers should empirically determine the suitability of the SKA2 ska2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SKA2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.