Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282374_IHC10.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded human placenta using SLC3A2/CD98hc Rabbit pAb (AAA282374) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

Rabbit SLC3A2/CD98hc Polyclonal Antibody | anti-SLC3A2/CD98hc antibody

SLC3A2/CD98hc Rabbit pAb

Gene Names
SLC3A2; 4F2; CD98; MDU1; 4F2HC; 4T2HC; NACAE; CD98HC
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
SLC3A2/CD98hc, Antibody; SLC3A2/CD98hc Rabbit pAb; 4F2; CD98; MDU1; 4F2HC; 4T2HC; NACAE; CD98HC; anti-SLC3A2/CD98hc antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300,50% glycerol,pH7.3.
Sequence
PGTPVFSYGDEIGLDAAALPGQPMEAPVMLWDESSFPDIPGAVSANMTVKGQSEDPGSLLSLFRRLSDQRSKERSLLHGDFHAFSAGPGLFSYIRHWDQNERFLVVLNFGDVGLSAGLQASDLPASASLPAKADLLLSTQPGREEGSPLELERLKLEPHEGLLLRFPYAA
Applicable Applications for anti-SLC3A2/CD98hc antibody
IHC (Immunohistochemistry), WB (Western Blot)
Positive Samples
Raji, HeLa, Rat lung
Cellular Location
Apical cell membrane, Melanosome, Single-pass type II membrane protein
Research Area
Epigenetics Nuclear Signaling, RNA Binding, Cancer, Signal Transduction, Endocrine Metabolism, Immunology Inflammation, CDs, Neuroscience, Calcium Signaling, Stem Cells, Hematopoietic Progenitors
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 461-630 of human SLC3A2/CD98hc (NP_002385.3).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Ship: Ice Pack

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded human placenta using SLC3A2/CD98hc Rabbit pAb (AAA282374) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

product-image-AAA282374_IHC10.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded human placenta using SLC3A2/CD98hc Rabbit pAb (AAA282374) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

IHC (Immunohistochemisry)

(Immunohistochemistry analysis of paraffin-embedded human esophageal cancer using SLC3A2/CD98hc Rabbit pAb (AAA282374) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

product-image-AAA282374_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry analysis of paraffin-embedded human esophageal cancer using SLC3A2/CD98hc Rabbit pAb (AAA282374) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

WB (Western Blot)

(Western blot analysis of Rat lung, using SLC3A2/CD98hc antibody (AAA282374) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 60s.)

product-image-AAA282374_WB13.jpg WB (Western Blot) (Western blot analysis of Rat lung, using SLC3A2/CD98hc antibody (AAA282374) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 60s.)

WB (Western Blot)

(Western blot analysis of various lysates, using SLC3A2/CD98hc antibody (AAA282374) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 3s.)

product-image-AAA282374_WB15.jpg WB (Western Blot) (Western blot analysis of various lysates, using SLC3A2/CD98hc antibody (AAA282374) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 3s.)
Related Product Information for anti-SLC3A2/CD98hc antibody
This gene is a member of the solute carrier family and encodes a cell surface, transmembrane protein. The protein exists as the heavy chain of a heterodimer, covalently bound through di-sulfide bonds to one of several possible light chains. The encoded transporter plays a role in regulation of intracellular calcium levels and transports L-type amino acids. Alternatively spliced transcript variants, encoding different isoforms, have been characterized.
Product Categories/Family for anti-SLC3A2/CD98hc antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
71,123 Da
NCBI Official Full Name
4F2 cell-surface antigen heavy chain
NCBI Official Synonym Full Names
solute carrier family 3 member 2
NCBI Official Symbol
SLC3A2
NCBI Official Synonym Symbols
4F2; CD98; MDU1; 4F2HC; 4T2HC; NACAE; CD98HC
NCBI Protein Information
4F2 cell-surface antigen heavy chain
UniProt Protein Name
4F2 cell-surface antigen heavy chain
UniProt Gene Name
SLC3A2
UniProt Synonym Gene Names
MDU1; 4F2hc

Similar Products

Product Notes

The SLC3A2/CD98hc slc3a2 (Catalog #AAA282374) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC3A2/CD98hc Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SLC3A2/CD98hc can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the SLC3A2/CD98hc slc3a2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PGTPVFSYGD EIGLDAAALP GQPMEAPVML WDESSFPDIP GAVSANMTVK GQSEDPGSLL SLFRRLSDQR SKERSLLHGD FHAFSAGPGL FSYIRHWDQN ERFLVVLNFG DVGLSAGLQA SDLPASASLP AKADLLLSTQ PGREEGSPLE LERLKLEPHE GLLLRFPYAA. It is sometimes possible for the material contained within the vial of "SLC3A2/CD98hc, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.