Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198187_WB13.jpg WB (Western Blot) (WB Suggested Anti-SMARCA1 Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: NIH/3T3 cell lysate)

Rabbit anti-Mouse, Rat SMARCA1 Polyclonal Antibody | anti-SMARCA1 antibody

SMARCA1 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
Smarca1; Snf2l; 5730494M04Rik
Reactivity
Mouse, Rat
Applications
Western Blot, Chromatin Immunoprecipitation, Immunoprecipitation
Purity
Protein A purified
Synonyms
SMARCA1, Antibody; SMARCA1 antibody - N-terminal region; anti-SMARCA1 antibody
Ordering
Host
Rabbit
Reactivity
Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VAVSDARATVVVVEDEQPGPSTFKEEGAAAAATEGTTATEKGEKKEKITS
Sequence Length
381
Applicable Applications for anti-SMARCA1 antibody
WB (Western Blot), ChIP (Chromatin immunoprecipitation)
Homology
Mouse: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of mouse SMARCA1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-SMARCA1 Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: NIH/3T3 cell lysate)

product-image-AAA198187_WB13.jpg WB (Western Blot) (WB Suggested Anti-SMARCA1 Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: NIH/3T3 cell lysate)

ChIP (Chromatin Immunoprecipitation)

(Chromatin Immunoprecipitation (ChIP) Using SMARCA1 antibody - N-terminal region and HCT116 Cells)

product-image-AAA198187_CHIP15.jpg ChIP (Chromatin Immunoprecipitation) (Chromatin Immunoprecipitation (ChIP) Using SMARCA1 antibody - N-terminal region and HCT116 Cells)
Related Product Information for anti-SMARCA1 antibody
This is a rabbit polyclonal antibody against SMARCA1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: cDNA library was prepared and sequenced in Mouse Genome Encyclopedia Project of Genome Exploration Research Group in Riken Genomic Sciences Center and Genome Science Laboratory in RIKEN.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
unnamed protein product
NCBI Official Synonym Full Names
SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 1
NCBI Official Symbol
Smarca1
NCBI Official Synonym Symbols
Snf2l; 5730494M04Rik
NCBI Protein Information
probable global transcription activator SNF2L1

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The SMARCA1 (Catalog #AAA198187) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SMARCA1 antibody - N-terminal region reacts with Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SMARCA1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), ChIP (Chromatin immunoprecipitation). Researchers should empirically determine the suitability of the SMARCA1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VAVSDARATV VVVEDEQPGP STFKEEGAAA AATEGTTATE KGEKKEKITS. It is sometimes possible for the material contained within the vial of "SMARCA1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.