Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46324_IHC10.jpg IHC (Immunohistochemistry) (Anti- SMC3 Picoband antibody, AAA46324, IHC(P)IHC(P): Human Intestinal Cancer Tissue)

SMC3 Polyclonal Antibody | anti-SMC3 antibody

Anti-SMC3 Antibody

Gene Names
SMC3; BAM; BMH; HCAP; CDLS3; CSPG6; SMC3L1
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
SMC3, Antibody; Anti-SMC3 Antibody; Structural maintenance of chromosomes protein 3; BAM; Bamacan; Basement membrane associated chondroitin proteoglycan; Basement membrane-associated chondroitin proteoglycan; BMH; CDLS3; chondroitin sulfate proteoglycan 6 (bamacan); Chondroitin sulfate proteoglycan 6; Chromosome associated polypeptide; Chromosome-associated polypeptide; CSPG 6; CSPG6; hCAP; SMC 3; SMC protein 3; SMC-3; smc3; SMC3_HUMAN; SMC3L1; Structural maintenance of chromosome 3; Structural maintenance of chromosomes 3; structural maintenance of chromosomes 3; anti-SMC3 antibody
Ordering
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
1217
Applicable Applications for anti-SMC3 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human SMC3 (1178-1216aa ELLESADKFYGVKFRNKVSHIDVITAEMAKDFVEDDTTH), identical to the related mouse sequence.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistochemistry)

(Anti- SMC3 Picoband antibody, AAA46324, IHC(P)IHC(P): Human Intestinal Cancer Tissue)

product-image-AAA46324_IHC10.jpg IHC (Immunohistochemistry) (Anti- SMC3 Picoband antibody, AAA46324, IHC(P)IHC(P): Human Intestinal Cancer Tissue)

IHC (Immunohistochemisry)

(Anti- SMC3 Picoband antibody, AAA46324, IHC(P)IHC(P): Rat Kidney Tissue)

product-image-AAA46324_IHC11.jpg IHC (Immunohistochemisry) (Anti- SMC3 Picoband antibody, AAA46324, IHC(P)IHC(P): Rat Kidney Tissue)

IHC (Immunohiostchemistry)

(Anti- SMC3 Picoband antibody, AAA46324, IHC(P)IHC(P): Mouse Intestine Tissue)

product-image-AAA46324_IHC13.jpg IHC (Immunohiostchemistry) (Anti- SMC3 Picoband antibody, AAA46324, IHC(P)IHC(P): Mouse Intestine Tissue)

WB (Western Blot)

(Anti- SMC3 Picoband antibody, AAA46324, Western blottingAll lanes: Anti SMC3 (AAA46324) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Rat Liver Tissue Lysate at 50ugLane 3: Rat Testis Tissue Lysate at 50ugLane 4: HELA Whole Cell Lysate at 40ugLane 5: A549 Whole Cell Lysate at 40ugLane 6: MCF-7 Whole Cell Lysate at 40ugLane 7: NIH3T3 Whole Cell Lysate at 40ugPredicted bind size: 140KDObserved bind size: 140KD)

product-image-AAA46324_WB15.jpg WB (Western Blot) (Anti- SMC3 Picoband antibody, AAA46324, Western blottingAll lanes: Anti SMC3 (AAA46324) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Rat Liver Tissue Lysate at 50ugLane 3: Rat Testis Tissue Lysate at 50ugLane 4: HELA Whole Cell Lysate at 40ugLane 5: A549 Whole Cell Lysate at 40ugLane 6: MCF-7 Whole Cell Lysate at 40ugLane 7: NIH3T3 Whole Cell Lysate at 40ugPredicted bind size: 140KDObserved bind size: 140KD)
Related Product Information for anti-SMC3 antibody
Description: Rabbit IgG polyclonal antibody for Structural maintenance of chromosomes protein 3(SMC3) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: Structural maintenance of chromosomes 3, also known as SMC3, is a human gene. This gene belongs to the SMC3 subfamily of SMC proteins. The encoded protein occurs in certain cell types as either an intracellular, nuclear protein or a secreted protein. The nuclear form, known as structural maintenance of chromosomes 3, is a component of the multimeric cohesin complex that holds together sister chromatids during mitosis, enabling proper chromosome segregation. Post-translational modification of the encoded protein by the addition of chondroitin sulfate chains gives rise to the secreted proteoglycan bamacan, an abundant basement membrane protein.
References
1. "Entrez Gene: SMC3 structural maintenance of chromosomes 3". 2. Ghiselli G, Coffee N, Munnery CE, Koratkar R, Siracusa LD (2003). "The cohesin SMC3 is a target the for beta-catenin/TCF4 transactivation pathway".J. Biol. Chem. 278 (22): 20259-67. 3. Patel CA, Ghiselli G (2005). "Hinderin, a five-domains protein including coiled-coil motifs that binds to SMC3". BMC Cell Biol. 6 (1): 3.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
141,542 Da
NCBI Official Full Name
structural maintenance of chromosomes protein 3
NCBI Official Synonym Full Names
structural maintenance of chromosomes 3
NCBI Official Symbol
SMC3
NCBI Official Synonym Symbols
BAM; BMH; HCAP; CDLS3; CSPG6; SMC3L1
NCBI Protein Information
structural maintenance of chromosomes protein 3
UniProt Protein Name
Structural maintenance of chromosomes protein 3
UniProt Gene Name
SMC3
UniProt Synonym Gene Names
BAM; BMH; CSPG6; SMC3L1; SMC protein 3; SMC-3; Bamacan; hCAP
UniProt Entry Name
SMC3_HUMAN

Similar Products

Product Notes

The SMC3 smc3 (Catalog #AAA46324) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-SMC3 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SMC3 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the SMC3 smc3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SMC3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.