Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199817_WB13.jpg WB (Western Blot) (WB Suggested Anti-SMC3 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysateThere is BioGPS gene expression data showing that SMC3 is expressed in HepG2)

Rabbit SMC3 Polyclonal Antibody | anti-SMC3 antibody

SMC3 antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
SMC3; BAM; BMH; HCAP; CDLS3; CSPG6; SMC3L1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
SMC3, Antibody; SMC3 antibody - C-terminal region; anti-SMC3 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GKATLVMKKGDVEGSQSQDEGEGSGESERGSGSQSSVPSVDQFTGVGIRV
Sequence Length
681
Applicable Applications for anti-SMC3 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human SMC3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-SMC3 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysateThere is BioGPS gene expression data showing that SMC3 is expressed in HepG2)

product-image-AAA199817_WB13.jpg WB (Western Blot) (WB Suggested Anti-SMC3 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysateThere is BioGPS gene expression data showing that SMC3 is expressed in HepG2)

IHC (Immunohistochemistry)

(Testis)

product-image-AAA199817_IHC15.jpg IHC (Immunohistochemistry) (Testis)
Related Product Information for anti-SMC3 antibody
This is a rabbit polyclonal antibody against SMC3. It was validated on Western Blot and immunohistochemistry

Target Description: SMC3 belongs to the SMC3 subfamily of SMC proteins. SMC3 occurs in certain cell types as either an intracellular, nuclear protein or a secreted protein. The nuclear form, known as structural maintenance of chromosomes 3, is a component of the multimeric cohesin complex that holds together sister chromatids during mitosis, enabling proper chromosome segregation.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
74kDa
NCBI Official Full Name
bamacan homolog
NCBI Official Synonym Full Names
structural maintenance of chromosomes 3
NCBI Official Symbol
SMC3
NCBI Official Synonym Symbols
BAM; BMH; HCAP; CDLS3; CSPG6; SMC3L1
NCBI Protein Information
structural maintenance of chromosomes protein 3
UniProt Protein Name
Structural maintenance of chromosomes protein 3
UniProt Gene Name
SMC3
UniProt Synonym Gene Names
BAM; BMH; CSPG6; SMC3L1; SMC protein 3; SMC-3; Bamacan; hCAP
UniProt Entry Name
SMC3_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The SMC3 smc3 (Catalog #AAA199817) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SMC3 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SMC3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the SMC3 smc3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GKATLVMKKG DVEGSQSQDE GEGSGESERG SGSQSSVPSV DQFTGVGIRV. It is sometimes possible for the material contained within the vial of "SMC3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.