Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23423_WB9.jpg WB (Western Blot) (Western Blot (WB)Host: RabbitTarget: SOX10Positive control (+): Rat brain (R-BR)Negative control (-): Mouse intestine (M-IN) Antibody concentration: 1ug/ml)

Rabbit SOX10 Polyclonal Antibody | anti-SOX10 antibody

SOX10 Antibody - middle region

Gene Names
SOX10; DOM; WS4; PCWH; WS2E; WS4C
Reactivity
Reactivity: Human
Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
SOX10, Antibody; SOX10 Antibody - middle region; anti-SOX10 antibody
Ordering
Host
Rabbit
Reactivity
Reactivity: Human
Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PGGEAEQGGTAAIQAHYKSAHLDHRHPGEGSPMSDGNPEHPSGQSHGPPT
Sequence Length
466
Applicable Applications for anti-SOX10 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Application Notes
Blocking Peptide: please indquire
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SOX10
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Western Blot (WB)Host: RabbitTarget: SOX10Positive control (+): Rat brain (R-BR)Negative control (-): Mouse intestine (M-IN) Antibody concentration: 1ug/ml)

product-image-AAA23423_WB9.jpg WB (Western Blot) (Western Blot (WB)Host: RabbitTarget: SOX10Positive control (+): Rat brain (R-BR)Negative control (-): Mouse intestine (M-IN) Antibody concentration: 1ug/ml)

WB (Western Blot)

(WB Suggested Anti-SOX10Antibody Titration: .25ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)

product-image-AAA23423_WB8.jpg WB (Western Blot) (WB Suggested Anti-SOX10Antibody Titration: .25ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)

WB (Western Blot)

(SOX10 antibody - middle region validated by WB using Hek 293 Whole Cell Lysate at 1:4,000.)

product-image-AAA23423_WB7.jpg WB (Western Blot) (SOX10 antibody - middle region validated by WB using Hek 293 Whole Cell Lysate at 1:4,000.)

WB (Western Blot)

(Host: RabbitTarget Name: SOX10Sample Type: Jurkat cell lysatesLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 2.5ug/mlPeptide Concentration: 4.0ug/mlLysate Quantity: 25ug/laneGel Concentration: 12%)

product-image-AAA23423_WB6.jpg WB (Western Blot) (Host: RabbitTarget Name: SOX10Sample Type: Jurkat cell lysatesLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 2.5ug/mlPeptide Concentration: 4.0ug/mlLysate Quantity: 25ug/laneGel Concentration: 12%)

WB (Western Blot)

(Host: RabbitTarget Name: SOX10Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 0.5ug/ml)

product-image-AAA23423_WB5.jpg WB (Western Blot) (Host: RabbitTarget Name: SOX10Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 0.5ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: SOX10Sample Tissue: Human MCF7 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA23423_WB4.jpg WB (Western Blot) (Host: RabbitTarget Name: SOX10Sample Tissue: Human MCF7 Whole CellAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(Immunohistochemistry with Skin tissue at an antibody concentration of 4-8ug/ml using anti-SOX10 antibody)

product-image-AAA23423_IHC3.jpg IHC (Immunohistochemistry) (Immunohistochemistry with Skin tissue at an antibody concentration of 4-8ug/ml using anti-SOX10 antibody)

IHC (Immunohistochemistry)

(Immunohistochemistry with Kidney lysate tissue at an antibody concentration of 4-8ug/ml using anti-SOX10 antibody)

product-image-AAA23423_IHC2.jpg IHC (Immunohistochemistry) (Immunohistochemistry with Kidney lysate tissue at an antibody concentration of 4-8ug/ml using anti-SOX10 antibody)

IHC (Immunohistochemistry)

(Sample Type: human optic nerves and spinal cordA/[IHC-PZ] (optimal processing)human optic nerve (short post mortem interval) fixed by immersion in zinc-based fixative (BD Pharmingen 552658), processed to minimize antigen loss (shortened protocol, reduced exposure to high temperature); embedded in paraffin wax; sectioned at 3 micronsA2/[IHC-PZ + FF]As above for initial fixation then post-fixed in 10% buffered formalin for 5 daysB/ [IHC-P]human optic nerve and spinal cord fixed in 10% buffered formalin (relatively short post mortem interval and fixation duration); standard processing; embedded in paraffin wax; sectioned at 3 micronsControlsNegative: omission of primary.Positive: Olig2 reactivity was in comparison with antibody from Prof Charles Stiles/ Dr John Alberta (DF308; N terminal Olig2) used at 1:10000 (IHC-PZ); 1:4000 (IHC-P))

product-image-AAA23423_IHC.jpg IHC (Immunohistochemistry) (Sample Type: human optic nerves and spinal cordA/[IHC-PZ] (optimal processing)human optic nerve (short post mortem interval) fixed by immersion in zinc-based fixative (BD Pharmingen 552658), processed to minimize antigen loss (shortened protocol, reduced exposure to high temperature); embedded in paraffin wax; sectioned at 3 micronsA2/[IHC-PZ + FF]As above for initial fixation then post-fixed in 10% buffered formalin for 5 daysB/ [IHC-P]human optic nerve and spinal cord fixed in 10% buffered formalin (relatively short post mortem interval and fixation duration); standard processing; embedded in paraffin wax; sectioned at 3 micronsControlsNegative: omission of primary.Positive: Olig2 reactivity was in comparison with antibody from Prof Charles Stiles/ Dr John Alberta (DF308; N terminal Olig2) used at 1:10000 (IHC-PZ); 1:4000 (IHC-P))
Related Product Information for anti-SOX10 antibody
SOX10 is a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. This protein may act as a transcriptional activator after forming a protein complex with other proteins. It acts as a nucleocytoplasmic shuttle protein and is important for neural crest and peripheral nervous system development. Mutations in this gene are associated with Waardenburg-Shah and Waardenburg-Hirschsprung disease.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50kDa
NCBI Official Full Name
transcription factor SOX-10
NCBI Official Synonym Full Names
SRY-box 10
NCBI Official Symbol
SOX10
NCBI Official Synonym Symbols
DOM; WS4; PCWH; WS2E; WS4C
NCBI Protein Information
transcription factor SOX-10
UniProt Protein Name
Transcription factor SOX-10
UniProt Gene Name
SOX10

Similar Products

Product Notes

The SOX10 sox10 (Catalog #AAA23423) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SOX10 Antibody - middle region reacts with Reactivity: Human Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SOX10 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Blocking Peptide: please indquire. Researchers should empirically determine the suitability of the SOX10 sox10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PGGEAEQGGT AAIQAHYKSA HLDHRHPGEG SPMSDGNPEH PSGQSHGPPT. It is sometimes possible for the material contained within the vial of "SOX10, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.