Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23535_WB6.jpg WB (Western Blot) (WB Suggested Anti-STK3 Antibody Titration: 5.0ug/mlPositive Control: HepG2 cell lysate)

Rabbit STK3 Polyclonal Antibody | anti-STK3 antibody

STK3 antibody - C-terminal region

Gene Names
STK3; KRS1; MST2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
STK3, Antibody; STK3 antibody - C-terminal region; anti-STK3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IEHNSTMLESDLGTMVINSEDEEEEDGTMKRNATSPQVQRPSFMDYFDKQ
Sequence Length
491
Applicable Applications for anti-STK3 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human STK3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-STK3 Antibody Titration: 5.0ug/mlPositive Control: HepG2 cell lysate)

product-image-AAA23535_WB6.jpg WB (Western Blot) (WB Suggested Anti-STK3 Antibody Titration: 5.0ug/mlPositive Control: HepG2 cell lysate)

WB (Western Blot)

(Lanes:Lane1: 100ug untransfected COS-7 lysateLane2: 100ug mock transfected Cos-7 lysateLane3: 100ug STK3 transfected Cos-7 lysateLane4: 50 ug STK3 transfected Cos-7 lysateLane5: 25 ug STK3 transfected Cos-7 lysatePrimary Antibody Dilution:1:2000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:5000Gene Name:STK3Submitted by:Anonymous)

product-image-AAA23535_WB5.jpg WB (Western Blot) (Lanes:Lane1: 100ug untransfected COS-7 lysateLane2: 100ug mock transfected Cos-7 lysateLane3: 100ug STK3 transfected Cos-7 lysateLane4: 50 ug STK3 transfected Cos-7 lysateLane5: 25 ug STK3 transfected Cos-7 lysatePrimary Antibody Dilution:1:2000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:5000Gene Name:STK3Submitted by:Anonymous)

WB (Western Blot)

(Lanes:Lane1: 100ug uninduced RPE-1 lysateLane2: 100ug uninduced RPE-1 lysateLane3: 100ug STK3 induced RPE-1 lysateLane4: 100ug STK3 induced RPE-1 lysatePrimary Antibody Dilution:1:2000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:5000Gene Name:STK3Submitted by:Anonymous)

product-image-AAA23535_WB4.jpg WB (Western Blot) (Lanes:Lane1: 100ug uninduced RPE-1 lysateLane2: 100ug uninduced RPE-1 lysateLane3: 100ug STK3 induced RPE-1 lysateLane4: 100ug STK3 induced RPE-1 lysatePrimary Antibody Dilution:1:2000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:5000Gene Name:STK3Submitted by:Anonymous)

WB (Western Blot)

(Host: RabbitTarget Name: STK3Sample Tissue: Human Lung TumorAntibody Dilution: 1.0ug/ml)

product-image-AAA23535_WB3.jpg WB (Western Blot) (Host: RabbitTarget Name: STK3Sample Tissue: Human Lung TumorAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: MouseTarget Name: STK3Sample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)

product-image-AAA23535_WB2.jpg WB (Western Blot) (Host: MouseTarget Name: STK3Sample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(Rabbit Anti-STK3 AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA23535_IHC.jpg IHC (Immunohistochemistry) (Rabbit Anti-STK3 AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Related Product Information for anti-STK3 antibody
This is a rabbit polyclonal antibody against STK3. It was validated on Western Blot and immunohistochemistry

Target Description: Protein kinase activation is a frequent response of cells to treatment with growth factors, chemicals, heat shock, or apoptosis-inducing agents. This protein kinase activation presumably allows cells to resist unfavorable environmental conditions. The yeast 'sterile 20' (Ste20) kinase acts upstream of the mitogen-activated protein kinase (MAPK) cascade that is activated under a variety of stress conditions. MST2 was identified as a kinase that is activated by the proapoptotic agents straurosporine and FAS ligand.Protein kinase activation is a frequent response of cells to treatment with growth factors, chemicals, heat shock, or apoptosis-inducing agents. This protein kinase activation presumably allows cells to resist unfavorable environmental conditions. The yeast 'sterile 20' (Ste20) kinase acts upstream of the mitogen-activated protein kinase (MAPK) cascade that is activated under a variety of stress conditions. MST2 was identified as a kinase that is activated by the proapoptotic agents straurosporine and FAS ligand (MIM 134638) (Taylor et al., 1996 [PubMed 8816758]; Lee et al., 2001 [PubMed 11278283]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-11 U26424.1 1-11 12-2826 BC010640.2 1-2815

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
serine/threonine-protein kinase 3 isoform 1
NCBI Official Synonym Full Names
serine/threonine kinase 3
NCBI Official Symbol
STK3
NCBI Official Synonym Symbols
KRS1; MST2
NCBI Protein Information
serine/threonine-protein kinase 3
UniProt Protein Name
Serine/threonine-protein kinase 3
UniProt Gene Name
STK3
UniProt Synonym Gene Names
KRS1; MST2; MST-2; MST2/N; MST2/C

Similar Products

Product Notes

The STK3 stk3 (Catalog #AAA23535) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The STK3 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's STK3 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the STK3 stk3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IEHNSTMLES DLGTMVINSE DEEEEDGTMK RNATSPQVQR PSFMDYFDKQ. It is sometimes possible for the material contained within the vial of "STK3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.