Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200472_WB10.jpg WB (Western Blot) (WB Suggested Anti-TBC1D1 antibody Titration: 1 ug/mLSample Type: Human heart)

Rabbit TBC1D1 Polyclonal Antibody | anti-TBC1D1 antibody

TBC1D1 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
TBC1D1; TBC; TBC1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
TBC1D1, Antibody; TBC1D1 antibody - middle region; anti-TBC1D1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RGSPGVSQRKLMRYHSVSTETPHERKDFESKANHLGDSGGTPVKTRRHSW
Sequence Length
1168
Applicable Applications for anti-TBC1D1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 79%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TBC1D1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-TBC1D1 antibody Titration: 1 ug/mLSample Type: Human heart)

product-image-AAA200472_WB10.jpg WB (Western Blot) (WB Suggested Anti-TBC1D1 antibody Titration: 1 ug/mLSample Type: Human heart)

WB (Western Blot)

(WB Suggested Anti-TBC1D1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 721_B cell lysateTBC1D1 is supported by BioGPS gene expression data to be expressed in 721_B)

product-image-AAA200472_WB11.jpg WB (Western Blot) (WB Suggested Anti-TBC1D1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 721_B cell lysateTBC1D1 is supported by BioGPS gene expression data to be expressed in 721_B)

WB (Western Blot)

(Host: RabbitTarget Name: TBC1D1Sample Tissue: Human ACHNAntibody Dilution: 1.0ug/ml)

product-image-AAA200472_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: TBC1D1Sample Tissue: Human ACHNAntibody Dilution: 1.0ug/ml)

IHC (Immunohistochemistry)

(Kidney)

product-image-AAA200472_IHC15.jpg IHC (Immunohistochemistry) (Kidney)
Related Product Information for anti-TBC1D1 antibody
This is a rabbit polyclonal antibody against TBC1D1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TBC1D1 is the founding member of a family of proteins sharing a 180- to 200-amino acid TBC domain presumed to have a role in regulating cell growth and differentiation. These proteins share significant homology with TRE2 (USP6), yeast Bub2, and CDC16.TBC1D1 is the founding member of a family of proteins sharing a 180- to 200-amino acid TBC domain presumed to have a role in regulating cell growth and differentiation. These proteins share significant homology with TRE2 (USP6; MIM 604334), yeast Bub2, and CDC16 (MIM 603461) (White et al., 2000 [PubMed 10965142]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-225 BC050321.1 13-237 226-950 BC050321.1 896-1620 951-1020 BC028196.1 226-295 1021-1123 BC029950.1 255-357 1124-1433 BC028196.1 399-708 1434-1608 BC029950.1 668-842 1609-4133 BC053648.1 437-2961 4134-5688 AK074954.1 1433-2987

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
133kDa
NCBI Official Full Name
TBC1 domain family member 1 isoform 1
NCBI Official Synonym Full Names
TBC1 domain family member 1
NCBI Official Symbol
TBC1D1
NCBI Official Synonym Symbols
TBC; TBC1
NCBI Protein Information
TBC1 domain family member 1
UniProt Protein Name
TBC1 domain family member 1
UniProt Gene Name
TBC1D1
UniProt Synonym Gene Names
KIAA1108
UniProt Entry Name
TBCD1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The TBC1D1 tbc1d1 (Catalog #AAA200472) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TBC1D1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TBC1D1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the TBC1D1 tbc1d1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RGSPGVSQRK LMRYHSVSTE TPHERKDFES KANHLGDSGG TPVKTRRHSW. It is sometimes possible for the material contained within the vial of "TBC1D1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.