Rabbit anti-Human TFRC Polyclonal Antibody | anti-TFRC antibody
TFRC antibody - N-terminal region
Gene Names
TFRC; T9; TR; TFR; p90; CD71; TFR1; TRFR; IMD46
Reactivity
Human
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
TFRC, Antibody; TFRC antibody - N-terminal region; anti-TFRC antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GYLGYCKGVEPKTECERLAGTESPVREEPGEDFPAARRLYWDDLKRKLSE
Sequence Length
760
Applicable Applications for anti-TFRC antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Human: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-TFRC antibody
This is a rabbit polyclonal antibody against TFRC. It was validated on Western Blot
Target Description: TFRC is a cellular uptake of iron occurs via receptor-mediated endocytosis of ligand-occupied transferrin receptor into specialized endosomes. Endosomal acidification leads to iron release. The apotransferrin-receptor complex is then recycled to the cell surface with a return to neutral pH and the concomitant loss of affinity of apotransferrin for its receptor. Transferrin receptor is necessary for development of erythrocytes and the nervous system By similarity. A second ligand, the heditary hemochromatosis protein HFE, competes for binding with transferrin for an overlapping C-terminal binding site.
Target Description: TFRC is a cellular uptake of iron occurs via receptor-mediated endocytosis of ligand-occupied transferrin receptor into specialized endosomes. Endosomal acidification leads to iron release. The apotransferrin-receptor complex is then recycled to the cell surface with a return to neutral pH and the concomitant loss of affinity of apotransferrin for its receptor. Transferrin receptor is necessary for development of erythrocytes and the nervous system By similarity. A second ligand, the heditary hemochromatosis protein HFE, competes for binding with transferrin for an overlapping C-terminal binding site.
Product Categories/Family for anti-TFRC antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
84kDa
NCBI Official Full Name
transferrin receptor protein 1 isoform 1
NCBI Official Synonym Full Names
transferrin receptor
NCBI Official Symbol
TFRC
NCBI Official Synonym Symbols
T9; TR; TFR; p90; CD71; TFR1; TRFR; IMD46
NCBI Protein Information
transferrin receptor protein 1
UniProt Protein Name
Transferrin receptor protein 1
UniProt Gene Name
TFRC
UniProt Synonym Gene Names
TR; TfR; TfR1; Trfr; sTfR
UniProt Entry Name
TFR1_HUMAN
Similar Products
Product Notes
The TFRC tfrc (Catalog #AAA201233) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TFRC antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TFRC can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the TFRC tfrc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GYLGYCKGVE PKTECERLAG TESPVREEPG EDFPAARRLY WDDLKRKLSE. It is sometimes possible for the material contained within the vial of "TFRC, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
