WB (Western Blot)
(Western blot analysis of extracts of various cell lines, using TOMM20 antibody.)
Rabbit TOM20 Polyclonal Antibody | anti-TOM20 antibody
Anti-TOM20 Antibody IHC-plus
Gene Names
TOMM20; MAS20; MOM19; TOM20
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunofluorescence, Immunohistochemistry
Purity
Affinity purified
Synonyms
TOM20, Antibody; Anti-TOM20 Antibody IHC-plus; Rabbit Polyclonal (IgG) to Human TOM20; Human TOM20; TOMM20; KIAA0016; MAS20; MOM19; anti-TOM20 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Specificity
Human TOM20.
Purity/Purification
Affinity purified
Form/Format
PBS, pH 7.3, 0.02% sodium azide, 50% glycerol.
Concentration
1 mg/ml (varies by lot)
Sequence Length
145
Applicable Applications for anti-TOM20 antibody
WB (Western Blot), IF (Immunofluorescence), IHC (Immunohistochemistry)
Immunogen Species
TOMM20 antibody was raised against Human.
Immunogen
TOMM20 antibody was raised against recombinant fusion protein containing a sequence corresponding to amino acids 20-145 of human TOMM20 (NP_055580.1).YCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE
Molecular Weight Note
While the observed MW by Western blot was 16 kDa.
Target Species
Human
Preparation and Storage
Store at -20 degree. Avoid freeze/thaw cycles.
WB (Western Blot)
(Western blot analysis of extracts of various cell lines, using TOMM20 antibody.)
WB (Western Blot)
(Western blot analysis of extracts of various cell lines, using TOMM20 antibody.)
IHC (Immunohiostchemistry)
(Human Adrenal: Formalin-Fixed, Paraffin-Embedded (FFPE))
IHC (Immunohiostchemistry)
(Human Adrenal: Formalin-Fixed, Paraffin-Embedded (FFPE))
IHC (Immunohistochemistry)
(Human Kidney: Formalin-Fixed, Paraffin-Embedded (FFPE))
IHC (Immunohistochemistry)
(Human Kidney: Formalin-Fixed, Paraffin-Embedded (FFPE))
Related Product Information for anti-TOM20 antibody
TOMM20 Antibody, KIAA0016 Antibody, MAS20 Antibody, MOM19 Antibody, TOM20 Antibody Description: Central component of the receptor complex responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. Together with TOM22 functions as the transit peptide receptor at the surface of the mitochondrion outer membrane and facilitates the movement of preproteins into the TOM40 translocation pore.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
16 kDa
NCBI Official Full Name
mitochondrial import receptor subunit TOM20 homolog
NCBI Official Synonym Full Names
translocase of outer mitochondrial membrane 20 homolog (yeast)
NCBI Official Symbol
TOMM20
NCBI Official Synonym Symbols
MAS20; MOM19; TOM20
NCBI Protein Information
mitochondrial import receptor subunit TOM20 homolog
UniProt Protein Name
Mitochondrial import receptor subunit TOM20 homolog
UniProt Gene Name
TOMM20
UniProt Synonym Gene Names
KIAA0016
UniProt Entry Name
TOM20_HUMAN
Similar Products
Product Notes
The TOM20 tomm20 (Catalog #AAA162139) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-TOM20 Antibody IHC-plus reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TOM20 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IF (Immunofluorescence), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the TOM20 tomm20 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TOM20, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.