Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA283202_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry analysis of paraffin-embedded Human cervix cancer tissue using Topo II? Rabbit pAb (AAA283202) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.)

Rabbit anti-Human Topo IIalpha Polyclonal Antibody | anti-TOP2A antibody

Topo IIalpha Rabbit pAb

Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
Topo IIalpha, Antibody; Topo IIalpha Rabbit pAb; TOP2A; TOP2; TP2A; DNA topoisomerase 2-alpha; Topo IIalpha; anti-TOP2A antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Sequence
GAKKRAAPKGTKRDPALNSGVSQKPDPAKTKNRRKRKPSTSDDSDSNFEKIVSKAVTSKKSKGESDDFHMDFDSAVAPRAKSVRAKKPIKYLEESDEDDLF
Applicable Applications for anti-TOP2A antibody
ELISA, IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1431-1531 of human Topo IIalpha (NP_001058.2).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IHC (Immunohistochemisry)

(Immunohistochemistry analysis of paraffin-embedded Human cervix cancer tissue using Topo II? Rabbit pAb (AAA283202) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.)

product-image-AAA283202_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry analysis of paraffin-embedded Human cervix cancer tissue using Topo II? Rabbit pAb (AAA283202) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.)

IHC (Immunohiostchemistry)

(Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using Topo II? Rabbit pAb (AAA283202) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.)

product-image-AAA283202_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using Topo II? Rabbit pAb (AAA283202) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.)

WB (Western Blot)

(Western blot analysis of lysates from HeLa cells, using Topo II? Rabbit pAb (AAA283202) at 1:400 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

product-image-AAA283202_WB15.jpg WB (Western Blot) (Western blot analysis of lysates from HeLa cells, using Topo II? Rabbit pAb (AAA283202) at 1:400 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)
Related Product Information for anti-TOP2A antibody
This gene encodes a DNA topoisomerase, an enzyme that controls and alters the topologic states of DNA during transcription. This nuclear enzyme is involved in processes such as chromosome condensation, chromatid separation, and the relief of torsional stress that occurs during DNA transcription and replication. It catalyzes the transient breaking and rejoining of two strands of duplex DNA which allows the strands to pass through one another, thus altering the topology of DNA. Two forms of this enzyme exist as likely products of a gene duplication event. The gene encoding this form, alpha, is localized to chromosome 17 and the beta gene is localized to chromosome 3. The gene encoding this enzyme functions as the target for several anticancer agents and a variety of mutations in this gene have been associated with the development of drug resistance. Reduced activity of this enzyme may also play a role in ataxia-telangiectasia.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 174kDa/177kDa/178kDa/182kDa
Observed MW: 190kDa
UniProt Protein Name
DNA topoisomerase 2-alpha
UniProt Gene Name
TOP2A
UniProt Synonym Gene Names
TOP2
UniProt Entry Name
TOP2A_HUMAN

Similar Products

Product Notes

The TOP2A top2a (Catalog #AAA283202) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Topo IIalpha Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Topo IIalpha can be used in a range of immunoassay formats including, but not limited to, ELISA, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the TOP2A top2a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GAKKRAAPKG TKRDPALNSG VSQKPDPAKT KNRRKRKPST SDDSDSNFEK IVSKAVTSKK SKGESDDFHM DFDSAVAPRA KSVRAKKPIK YLEESDEDDL F. It is sometimes possible for the material contained within the vial of "Topo IIalpha, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.