WB (Western Blot)
(WB Suggested Anti-TP53 AntibodyTitration: 0.5 ug/mlPositive Control: DU145 CELLSTP53 is strongly supported by BioGPS gene expression data to be expressed in Human DU145 cells)
Rabbit TP53 Polyclonal Antibody | anti-TP53 antibody
TP53 antibody - C-terminal region
Gene Names
TP53; P53; BCC7; LFS1; BMFS5; TRP53
Reactivity
Horse, Human, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
TP53, Antibody; TP53 antibody - C-terminal region; anti-TP53 antibody
Host
Rabbit
Reactivity
Horse, Human, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RELNEALELKDAQAGKEPGGSRAHSSHLKSKKGQSTSRHKKLMFKTEGPD
Sequence Length
393
Applicable Applications for anti-TP53 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Horse: 93%; Human: 100%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human TP53
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-TP53 AntibodyTitration: 0.5 ug/mlPositive Control: DU145 CELLSTP53 is strongly supported by BioGPS gene expression data to be expressed in Human DU145 cells)
WB (Western Blot)
(WB Suggested Anti-TP53 AntibodyTitration: 0.5 ug/mlPositive Control: DU145 CELLSTP53 is strongly supported by BioGPS gene expression data to be expressed in Human DU145 cells)
IHC (Immunohistochemistry)
(Rabbit Anti-TP53 antibodyParaffin Embedded Tissue: Human Lung cell Cellular Data: bronchiole epithelium of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
IHC (Immunohistochemistry)
(Rabbit Anti-TP53 antibodyParaffin Embedded Tissue: Human Lung cell Cellular Data: bronchiole epithelium of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Related Product Information for anti-TP53 antibody
This is a rabbit polyclonal antibody against TP53. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: TP53 acts as a tumor suppressor in many tumor types; induces growth arrest or apoptosis depending on the physiological circumstances and cell type. Involved in cell cycle regulation as a trans-activator that acts to negatively regulate cell division by controlling a set of genes required for this process.
Target Description: TP53 acts as a tumor suppressor in many tumor types; induces growth arrest or apoptosis depending on the physiological circumstances and cell type. Involved in cell cycle regulation as a trans-activator that acts to negatively regulate cell division by controlling a set of genes required for this process.
Product Categories/Family for anti-TP53 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
cellular tumor antigen p53 isoform a
NCBI Official Synonym Full Names
tumor protein p53
NCBI Official Symbol
TP53
NCBI Official Synonym Symbols
P53; BCC7; LFS1; BMFS5; TRP53
NCBI Protein Information
cellular tumor antigen p53
UniProt Protein Name
Cellular tumor antigen p53
UniProt Gene Name
TP53
UniProt Synonym Gene Names
P53
UniProt Entry Name
P53_HUMAN
Similar Products
Product Notes
The TP53 tp53 (Catalog #AAA201667) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TP53 antibody - C-terminal region reacts with Horse, Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TP53 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the TP53 tp53 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RELNEALELK DAQAGKEPGG SRAHSSHLKS KKGQSTSRHK KLMFKTEGPD. It is sometimes possible for the material contained within the vial of "TP53, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.