Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198453_WB13.jpg WB (Western Blot) (WB Suggested Anti-TRIM33 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Hela cell lysateTRIM33 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells)

Rabbit TRIM33 Polyclonal Antibody | anti-TRIM33 antibody

TRIM33 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
TRIM33; ECTO; PTC7; RFG7; TF1G; TIF1G; TIFGAMMA; TIF1GAMMA
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot, Immunofluorescence
Purity
Affinity Purified
Synonyms
TRIM33, Antibody; TRIM33 antibody - middle region; anti-TRIM33 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EIYSDRTFAPLPEFEQEEDDGEVTEDSDEDFIQPRRKRLKSDERPVHIK
Sequence Length
1127
Applicable Applications for anti-TRIM33 antibody
WB (Western Blot), IF (Immunofluorescence)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TRIM33
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-TRIM33 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Hela cell lysateTRIM33 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells)

product-image-AAA198453_WB13.jpg WB (Western Blot) (WB Suggested Anti-TRIM33 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Hela cell lysateTRIM33 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells)

IF (Immunofluorescence)

(Sample Type :MCF7Primary Antibody Dilution:4 ug/mlSecondary Antibody :Anti-rabbit Alexa 546Secondary Antibody Dilution:2 ug/mlGene Name :TRIM33)

product-image-AAA198453_IF15.jpg IF (Immunofluorescence) (Sample Type :MCF7Primary Antibody Dilution:4 ug/mlSecondary Antibody :Anti-rabbit Alexa 546Secondary Antibody Dilution:2 ug/mlGene Name :TRIM33)
Related Product Information for anti-TRIM33 antibody
This is a rabbit polyclonal antibody against TRIM33. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TRIM33 is thought to be a transcriptional corepressor. However, molecules that interact with this protein have not yet been identified. The protein is a member of the tripartite motif family. This motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region.The protein encoded by this gene is thought to be a transcriptional corepressor. However, molecules that interact with this protein have not yet been identified. The protein is a member of the tripartite motif family. This motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. Three alternatively spliced transcript variants for this gene have been described, however, the full-length nature of one variant has not been determined.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
122kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase TRIM33 isoform alpha
NCBI Official Synonym Full Names
tripartite motif containing 33
NCBI Official Symbol
TRIM33
NCBI Official Synonym Symbols
ECTO; PTC7; RFG7; TF1G; TIF1G; TIFGAMMA; TIF1GAMMA
NCBI Protein Information
E3 ubiquitin-protein ligase TRIM33
UniProt Protein Name
E3 ubiquitin-protein ligase TRIM33
UniProt Gene Name
TRIM33
UniProt Synonym Gene Names
KIAA1113; RFG7; TIF1G; Protein Rfg7; TIF1-gamma
UniProt Entry Name
TRI33_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The TRIM33 trim33 (Catalog #AAA198453) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TRIM33 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TRIM33 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IF (Immunofluorescence). Researchers should empirically determine the suitability of the TRIM33 trim33 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EIYSDRTFAP LPEFEQEEDD GEVTEDSDED FIQPRRKRLK SDERPVHIK. It is sometimes possible for the material contained within the vial of "TRIM33, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.