anti-Human UHRF1 Polyclonal Antibody | anti-UHRF1 antibody

Anti-UHRF1 Antibody

Cat. Num. AAA46257

• Gene Names: UHRF1; Np95; hNP95; ICBP90; RNF106; TDRD22; hUHRF1; huNp95
• Reactivity: Human
• Applications: Immunohistochemistry, Western Blot
• Purity: Immunogen Affinity Purified
• Synonyms: UHRF1, Antibody; Anti-UHRF1 Antibody; E3 ubiquitin-protein ligase UHRF1; Ac2-121; AL022808; EC 6.3.2.-; FLJ21925; hNP95; hUHRF1; HuNp95; ICBP90; Inverted CCAAT box binding protein of 90 kDa; Inverted CCAAT box binding protein, 90-kD; Inverted CCAAT box-binding protein of 90 kDa; Liver regeneration-related protein LRRG126; MGC138707; NP95; Nuclear phosphoprotein, 95-KD; Nuclear protein 95; Nuclear zinc finger protein Np95; RING finger protein 106; RNF106; Transcription factor ICBP90; Ubiquitin like containing PHD and RING finger domains protein 1; Ubiquitin like PHD and RING finger domain containing protein 1; Ubiquitin-like PHD and RING finger domain-containing protein 1; Ubiquitin-like protein containing PHD and RING finger domains 1; Ubiquitin-like with PHD and ring finger domains 1; Ubiquitin-like, containing PHD and RING finger domains, 1; Ubiquitin-like-containing PHD and RING finger domains protein 1; UHRF1; UHRF1_HUMAN; ubiquitin-like with PHD and ring finger domains 1; anti-UHRF1 antibody

• Reactivity: Human
• Clonality: Polyclonal
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 793

• Applicable Applications for anti-UHRF1 antibody: IHC (Immunohistochemistry), WB (Western Blot)
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human UHRF1 (14-51aa HTVDSLSRLTKVEELRRKIQELFHVEPGLQRLFYRGKQ), different from the related mouse sequence by six amino acids, and from the related rat sequence by five amino acids.
• Ig Type: Rabbit IgG
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohiostchemistry)

(UHRF1 was detected in paraffin-embedded sections of human intestinal cancer tissues using rabbit anti- UHRF1 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

WB (Western Blot)

(Western blot analysis of UHRF1 expression in MCF-7 whole cell lysates (lane 1) and U2OS whole cell lysates (lane 2). UHRF1 at 90KD was detected using rabbit anti- UHRF1 Antigen Affinity purified polyclonal antibody at0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method.)

Related Product Information for anti-UHRF1 antibody

Description: Rabbit IgG polyclonal antibody for E3 ubiquitin-protein ligase UHRF1(UHRF1) detection. Tested with WB, IHC-P in Human.

Background: Ubiquitin-like, containing PHD and RING finger domains, 1 is a protein which in humans is encoded by the UHRF1 gene. This gene encodes a member of a subfamily of RING-finger type E3 ubiquitin ligases. The protein binds to specific DNA sequences, and recruits a histone deacetylase to regulate gene expression. Its expression peaks at late G1 phase and continues during G2 and M phases of the cell cycle. It plays a major role in the G1/S transition by regulating topoisomerase IIalpha and retinoblastoma gene expression, and functions in the p53-dependent DNA damage checkpoint. It is regarded as a hub protein for the integration of epigenetic information. This gene is up-regulated in various cancers, and it is therefore considered to be a therapeutic target. Multiple transcript variants encoding different isoforms have been found for this gene. A related pseudogene exists on chromosome 12.

References

1. "Entrez Gene: UHRF1 ubiquitin-like, containing PHD and RING finger domains, 1". 2. Hopfner R, Mousli M, Jeltsch JM, Voulgaris A, Lutz Y, Marin C, Bellocq JP, Oudet P, Bronner C (Jan 2000)."ICBP90, a novel human CCAAT binding protein, involved in the regulation of topoisomerase IIalpha expression".Cancer Research 60 (1): 121-8.

NCBI and Uniprot Product Information

• NCBI GI #: 115430235
• NCBI GeneID: 29128
• NCBI Accession #: NP_001041666.1
• NCBI GenBank Nucleotide #: NM_001048201.2
• UniProt Accession #: Q96T88; Q2HIX7; Q8J022; Q9H6S6; Q9P115; Q9P1U7; A0JBR2; A8K024; B2RBA9
• Molecular Weight: 91,116 Da
• NCBI Official Full Name: E3 ubiquitin-protein ligase UHRF1 isoform 1
• NCBI Official Synonym Full Names: ubiquitin like with PHD and ring finger domains 1
• NCBI Official Symbol: UHRF1
• NCBI Official Synonym Symbols: Np95; hNP95; ICBP90; RNF106; TDRD22; hUHRF1; huNp95
• NCBI Protein Information: E3 ubiquitin-protein ligase UHRF1
• UniProt Protein Name: E3 ubiquitin-protein ligase UHRF1
• UniProt Gene Name: UHRF1
• UniProt Synonym Gene Names: ICBP90; NP95; RNF106; HuNp95; hNp95; hUHRF1
• UniProt Entry Name: UHRF1_HUMAN