Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Rabbit anti-Human USH2A Polyclonal Antibody | anti-USH2A antibody

USH2A Rabbit pAb

Gene Names
USH2A; US2; RP39; USH2; dJ1111A8.1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purification
Synonyms
USH2A, Antibody; USH2A Rabbit pAb; US2; RP39; USH2; dJ1111A8.1; anti-USH2A antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
Liquid
PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Sequence
FSPQPTEIRIQRKKENSLDWEDWQYFARNCGAFGMKNNGDLEKPDSVNCLQLSNFTPYSRGNVTFSILTPGPNYRPGYNNFYNTPSLQEFVKATQIRFHFHGQYYTTETAVNLRHRYYAVDEITISGRCQC
Applicable Applications for anti-USH2A antibody
WB (Western Blot)
Cellular Location
apical plasma membrane, basement membrane, ciliary basal body, cytoplasm, extracellular region, stereocilium membrane
Research Area
Neuroscience
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 390-520 of human USH2A (NP_996816.2).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Ship: Ice Pack
Related Product Information for anti-USH2A antibody
This gene encodes a protein that contains laminin EGF motifs, a pentaxin domain, and many fibronectin type III motifs. The protein is found in the basement membrane, and may be important in development and homeostasis of the inner ear and retina. Mutations within this gene have been associated with Usher syndrome type IIa and retinitis pigmentosa. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-USH2A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
usherin isoform A
NCBI Official Synonym Full Names
usherin
NCBI Official Symbol
USH2A
NCBI Official Synonym Symbols
US2; RP39; USH2; dJ1111A8.1
NCBI Protein Information
usherin
UniProt Protein Name
Usherin
UniProt Gene Name
USH2A
UniProt Entry Name
USH2A_HUMAN

Similar Products

Product Notes

The USH2A ush2a (Catalog #AAA282382) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The USH2A Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's USH2A can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the USH2A ush2a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: FSPQPTEIRI QRKKENSLDW EDWQYFARNC GAFGMKNNGD LEKPDSVNCL QLSNFTPYSR GNVTFSILTP GPNYRPGYNN FYNTPSLQEF VKATQIRFHF HGQYYTTETA VNLRHRYYAV DEITISGRCQ C. It is sometimes possible for the material contained within the vial of "USH2A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.