Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281644_IF10.jpg IF (Immunofluorescence) (Immunofluorescence analysis of OVCAR-3 cells using WT1 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

Rabbit WT1 Polyclonal Antibody | anti-WT1 antibody

WT1 Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
WT1; GUD; AWT1; WAGR; WT33; NPHS4; WIT-2; EWS-WT1
Reactivity
Human, Mouse, Rat
Applications
Immunofluorescence, Western Blot
Purity
Affinity purification
Synonyms
WT1, Antibody; WT1 Rabbit pAb; WT1; AWT1; EWS-WT1; GUD; NPHS4; WAGR; WIT-2; WT33; anti-WT1 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300,50% glycerol,pH7.3.
Sequence
MEKGYSTVTFDGTPSYGHTPSHHAAQFPNHSFKHEDPMGQQGSLGEQQYSVPPPVYGCHTPTDSCTGSQALLLRTPYSSDNLYQMTSQLECMTWNQMNLGATLKGVAAGSSSSVKWTEGQSNHSTGYESDNHTTPILCGAQYRIHTHGVFRGIQDVRRVPGVAPTLVRSASETSEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQRNMTKLQLAL
Applicable Applications for anti-WT1 antibody
IF (Immunofluorescence), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-302 of human WT1 (NP_001185480.1).
Cellular Location
Cytoplasm, Nucleus, Nucleus speckle, nucleolus, nucleoplasm
Positive Samples
Mouse uterus, Rat kidney, Rat testis
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of OVCAR-3 cells using WT1 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA281644_IF10.jpg IF (Immunofluorescence) (Immunofluorescence analysis of OVCAR-3 cells using WT1 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Confocal immunofluorescence analysis of U-2 OS cells using WT1 Polyclonal Antibody at dilution of 1:200. Blue: DAPI for nuclear staining.)

product-image-AAA281644_IF11.jpg IF (Immunofluorescence) (Confocal immunofluorescence analysis of U-2 OS cells using WT1 Polyclonal Antibody at dilution of 1:200. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Confocal immunofluorescence analysis of Hela cells using WT1 Polyclonal Antibody at dilution of 1:200. Blue: DAPI for nuclear staining.)

product-image-AAA281644_IF13.jpg IF (Immunofluorescence) (Confocal immunofluorescence analysis of Hela cells using WT1 Polyclonal Antibody at dilution of 1:200. Blue: DAPI for nuclear staining.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using WT1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)

product-image-AAA281644_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using WT1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)
Related Product Information for anti-WT1 antibody
Background: This gene encodes a transcription factor that contains four zinc-finger motifs at the C-terminus and a proline/glutamine-rich DNA-binding domain at the N-terminus. It has an essential role in the normal development of the urogenital system, and it is mutated in a small subset of patients with Wilms tumor. This gene exhibits complex tissue-specific and polymorphic imprinting pattern, with biallelic, and monoallelic expression from the maternal and paternal alleles in different tissues. Multiple transcript variants have been described. In several variants, there is evidence for the use of a non-AUG (CUG) translation initiation codon upstream of, and in-frame with the first AUG. Authors of PMID:7926762 also provide evidence that WT1 mRNA undergoes RNA editing in human and rat, and that this process is tissue-restricted and developmentally regulated.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49,188 Da
NCBI Official Full Name
Wilms tumor protein isoform B
NCBI Official Synonym Full Names
Wilms tumor 1
NCBI Official Symbol
WT1
NCBI Official Synonym Symbols
GUD; AWT1; WAGR; WT33; NPHS4; WIT-2; EWS-WT1
NCBI Protein Information
Wilms tumor protein; amino-terminal domain of EWS|last three zinc fingers of the DNA-binding domain of WT1
UniProt Protein Name
Wilms tumor protein
UniProt Gene Name
WT1
UniProt Entry Name
WT1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The WT1 wt1 (Catalog #AAA281644) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The WT1 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's WT1 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the WT1 wt1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MEKGYSTVTF DGTPSYGHTP SHHAAQFPNH SFKHEDPMGQ QGSLGEQQYS VPPPVYGCHT PTDSCTGSQA LLLRTPYSSD NLYQMTSQLE CMTWNQMNLG ATLKGVAAGS SSSVKWTEGQ SNHSTGYESD NHTTPILCGA QYRIHTHGVF RGIQDVRRVP GVAPTLVRSA SETSEKRPFM CAYPGCNKRY FKLSHLQMHS RKHTGEKPYQ CDFKDCERRF SRSDQLKRHQ RRHTGVKPFQ CKTCQRKFSR SDHLKTHTRT HTGEKPFSCR WPSCQKKFAR SDELVRHHNM HQRNMTKLQL AL. It is sometimes possible for the material contained within the vial of "WT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.