Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198222_WB13.jpg WB (Western Blot) (WB Suggested Anti-WT1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HT1080 cell lysate)

Rabbit WT1 Polyclonal Antibody | anti-WT1 antibody

WT1 antibody - middle region

Gene Names
WT1; GUD; AWT1; WAGR; WT33; NPHS4; WIT-2
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
WT1, Antibody; WT1 antibody - middle region; anti-WT1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQRNMTKLQLA
Sequence Length
514
Applicable Applications for anti-WT1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 93%; Dog: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human WT1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-WT1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HT1080 cell lysate)

product-image-AAA198222_WB13.jpg WB (Western Blot) (WB Suggested Anti-WT1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HT1080 cell lysate)

IHC (Immunohistochemistry)

(Human Testis)

product-image-AAA198222_IHC15.jpg IHC (Immunohistochemistry) (Human Testis)
Related Product Information for anti-WT1 antibody
This is a rabbit polyclonal antibody against WT1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: WT1 is a transcription factor that contains four zinc-finger motifs at the C-terminus and a proline/glutamine-rich DNA-binding domain at the N-terminus. It has an essential role in the normal development of the urogenital system, and it is mutated in a sm

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
Wilms tumor protein isoform B
NCBI Official Synonym Full Names
WT1 transcription factor
NCBI Official Symbol
WT1
NCBI Official Synonym Symbols
GUD; AWT1; WAGR; WT33; NPHS4; WIT-2
NCBI Protein Information
Wilms tumor protein
UniProt Protein Name
Wilms tumor protein
UniProt Gene Name
WT1
UniProt Entry Name
WT1_HUMAN

Similar Products

Product Notes

The WT1 wt1 (Catalog #AAA198222) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The WT1 antibody - middle region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's WT1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the WT1 wt1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DHLKTHTRTH TGEKPFSCRW PSCQKKFARS DELVRHHNMH QRNMTKLQLA. It is sometimes possible for the material contained within the vial of "WT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.