Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200679_WB13.jpg WB (Western Blot) (WB Suggested Anti-XAF1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Hela cell lysate)

Rabbit anti-Human XAF1 Polyclonal Antibody | anti-XAF1 antibody

XAF1 antibody - middle region

Gene Names
XAF1; BIRC4BP; XIAPAF1; HSXIAPAF1
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
XAF1, Antibody; XAF1 antibody - middle region; anti-XAF1 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SRTELCQGCGQFIMHRMLAQHRDVCRSEQAQLGKGERISAPEREIYCHYC
Sequence Length
301
Applicable Applications for anti-XAF1 antibody
WB (Western Blot)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human XAF1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-XAF1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Hela cell lysate)

product-image-AAA200679_WB13.jpg WB (Western Blot) (WB Suggested Anti-XAF1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Hela cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: XAF1Sample Type: Human JurkatAntibody Dilution: 1.0ug/mlXAF1 is supported by BioGPS gene expression data to be expressed in Jurkat)

product-image-AAA200679_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: XAF1Sample Type: Human JurkatAntibody Dilution: 1.0ug/mlXAF1 is supported by BioGPS gene expression data to be expressed in Jurkat)
Related Product Information for anti-XAF1 antibody
This is a rabbit polyclonal antibody against XAF1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: X-linked inhibitor of apoptosis (XIAP; MIM 300079) is a potent member of the IAP family. All members of this family possess baculoviral IAP (BIR) repeats, cysteine-rich domains of approximately 80 amino acids that bind and inhibit caspases (e.g., CASP3; M
Product Categories/Family for anti-XAF1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
XIAP-associated factor 1 isoform 1
NCBI Official Synonym Full Names
XIAP associated factor 1
NCBI Official Symbol
XAF1
NCBI Official Synonym Symbols
BIRC4BP; XIAPAF1; HSXIAPAF1
NCBI Protein Information
XIAP-associated factor 1
UniProt Protein Name
XIAP-associated factor 1
UniProt Gene Name
XAF1
UniProt Synonym Gene Names
BIRC4BP; XIAPAF1
UniProt Entry Name
XAF1_HUMAN

Similar Products

Product Notes

The XAF1 xaf1 (Catalog #AAA200679) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The XAF1 antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's XAF1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the XAF1 xaf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SRTELCQGCG QFIMHRMLAQ HRDVCRSEQA QLGKGERISA PEREIYCHYC. It is sometimes possible for the material contained within the vial of "XAF1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.