Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein (PREX1) Recombinant Protein | PREX1 recombinant protein

Recombinant Human Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein (PREX1) , partial

Average rating 0.0
No ratings yet
Gene Names
PREX1; P-REX1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein (PREX1); N/A; Recombinant Human Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein (PREX1) , partial; PREX1 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
49-392. Partial.
Sequence
LRLCVLNEILGTERDYVGTLRFLQSAFLHRIRQNVADSVEKGLTEENVKVLFSNIEDILEVHKDFLAALEYCLHPEPQSQHELGNVFLKFKDKFCVYEEYCSNHEKALRLLVELNKIPTVRAFLLSCMLLGGRKTTDIPLEGYLLSPIQRICKYPLLLKELAKRTPGKHPDHPAVQSALQAMKTVCSNINETKRQMEKLEALEQLQSHIEGWEGSNLTDICTQLLLQGTLLKISAGNIQERAFFLFDNLLVYCKRKSRVTGSKKSTKRTKSING SLYIFRGRINTEVMEVENVEDGTADYHSNGYTVTNGWKIHNTAKNKWFVCMAKTAEEKQKWLDAIIRERE
Sequence Length
392
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for PREX1 recombinant protein
This protein acts as a guanine nucleotide exchange factor for the RHO family of small GTP-binding proteins (RACs). It has been shown to bind to and activate RAC1 by exchanging bound GDP for free GTP. The encoded protein, which is found mainly in the cytoplasm, is activated by phosphatidylinositol-3,4,5-trisphosphate and the beta-gamma subunits of heterotrimeric G proteins.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
175,847 Da
NCBI Official Full Name
phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein
NCBI Official Synonym Full Names
phosphatidylinositol-3,4,5-trisphosphate dependent Rac exchange factor 1
NCBI Official Symbol
PREX1
NCBI Official Synonym Symbols
P-REX1
NCBI Protein Information
phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein
UniProt Protein Name
Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein
UniProt Gene Name
PREX1
UniProt Synonym Gene Names
KIAA1415; P-Rex1; PtdIns(3,4,5)-dependent Rac exchanger 1

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The PREX1 prex1 (Catalog #AAA116680) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 49-392. Partial. The amino acid sequence is listed below: LRLCVLNEIL GTERDYVGTL RFLQSAFLHR IRQNVADSVE KGLTEENVKV LFSNIEDILE VHKDFLAALE YCLHPEPQSQ HELGNVFLKF KDKFCVYEEY CSNHEKALRL LVELNKIPTV RAFLLSCMLL GGRKTTDIPL EGYLLSPIQR ICKYPLLLKE LAKRTPGKHP DHPAVQSALQ AMKTVCSNIN ETKRQMEKLE ALEQLQSHIE GWEGSNLTDI CTQLLLQGTL LKISAGNIQE RAFFLFDNLL VYCKRKSRVT GSKKSTKRTK SING SLYIF RGRINTEVME VENVEDGTAD YHSNGYTVTN GWKIHNTAKN KWFVCMAKTA EEKQKWLDAI IRERE. It is sometimes possible for the material contained within the vial of "Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein (PREX1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.