Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA230854_SDS_PAGE15.jpg SDS-PAGE

Prolactin receptor Recombinant Protein | PRLR recombinant protein

Prolactin receptor

Gene Names
PRLR; HPRL; MFAB; hPRLrI
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Prolactin receptor; N/A; PRLR recombinant protein
Ordering
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
25-622. Full Length of Mature Protein
Sequence
QLPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPATFIQIPSDFTMNDTTVWISVAVLSAVICLIIVWAVALKGYSMVTCIFPPVPGPKIKGFDAHLLEKGKSEELLSALGCQDFPPTSDYEDLLVEYLEVDDSEDQHLMSVHSKEHPSQGMKPTYLDPDTDSGRGSCDSPSLLSEKCEEPQANPSTFYDPEVIEKPENPETTHTWDPQCISMEGKIPYFHAGGSKCSTWPLPQPSQHNPRSSYHNITDVCELAVGPAGAPATLLNEAGKDALKSSQTIKSREEGKATQQREVESFHSETDQDTPWLLPQEKTPFGSAKPLDYVEIHKVNKDGALSLLPKQRENSGKPKKPGTPENNKEYAKVSGVMDNNILVLVPDPHAKNVACFEESAKEAPPSLEQNQAEKALANFTATSSKCRLQLGGLDYLDPACFTHSFH
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

SDS-PAGE

product-image-AAA230854_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for PRLR recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for PRLR recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
71.9 kDa
NCBI Official Full Name
prolactin receptor isoform 1
NCBI Official Synonym Full Names
prolactin receptor
NCBI Official Symbol
PRLR
NCBI Official Synonym Symbols
HPRL; MFAB; hPRLrI
NCBI Protein Information
prolactin receptor
UniProt Protein Name
Prolactin receptor
UniProt Gene Name
PRLR
UniProt Synonym Gene Names
PRL-R
UniProt Entry Name
PRLR_HUMAN

Similar Products

Product Notes

The PRLR prlr (Catalog #AAA230854) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 25-622. Full Length of Mature Protein. The amino acid sequence is listed below: QLPPGKPEIF KCRSPNKETF TCWWRPGTDG GLPTNYSLTY HREGETLMHE CPDYITGGPN SCHFGKQYTS MWRTYIMMVN ATNQMGSSFS DELYVDVTYI VQPDPPLELA VEVKQPEDRK PYLWIKWSPP TLIDLKTGWF TLLYEIRLKP EKAAEWEIHF AGQQTEFKIL SLHPGQKYLV QVRCKPDHGY WSAWSPATFI QIPSDFTMND TTVWISVAVL SAVICLIIVW AVALKGYSMV TCIFPPVPGP KIKGFDAHLL EKGKSEELLS ALGCQDFPPT SDYEDLLVEY LEVDDSEDQH LMSVHSKEHP SQGMKPTYLD PDTDSGRGSC DSPSLLSEKC EEPQANPSTF YDPEVIEKPE NPETTHTWDP QCISMEGKIP YFHAGGSKCS TWPLPQPSQH NPRSSYHNIT DVCELAVGPA GAPATLLNEA GKDALKSSQT IKSREEGKAT QQREVESFHS ETDQDTPWLL PQEKTPFGSA KPLDYVEIHK VNKDGALSLL PKQRENSGKP KKPGTPENNK EYAKVSGVMD NNILVLVPDP HAKNVACFEE SAKEAPPSLE QNQAEKALAN FTATSSKCRL QLGGLDYLDP ACFTHSFH. It is sometimes possible for the material contained within the vial of "Prolactin receptor, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.