Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Nrf2 protein

Nrf2 protein

Average rating 0.0
No ratings yet
Gene Names
NFE2L2; NRF2; HEBP1; IMDDHH
Synonyms
Nrf2; N/A; Nrf2 protein; NFE2L2, NRF2, NFE2 like bZIP transcription factor 2, Nuclear factor erythroid 2-related factor 2 (NF-E2-related factor 2) (NFE2-related factor 2) (HEBP1) (Nuclear factor, erythroid derived 2, like 2)
Ordering
Form/Format
Liquid in PBS ; 0.15 M Phosphate buffered saline, pH 7.4
Concentration
SDS-PAGE >90% (varies by lot)
Sequence
Amino acid: 11-130, with his-MBP tag. LPSQQDMDLIDILWRQDIDLGVSREVFDFSQRRKEYELEKQKKLEKERQEQLQKEQEKAFFAQLQLDEE TGEFLPIQPAQHIQSETSGSANYSQVAHIPKSDALYFDDCM
Sequence Length
589
Expression
E. coli
Vector and tag
C-His tag
Solubility
Soluble
Function
Transcription, transcription, DNA-dependent, regulation of transcription, DNA-dependent,transcription from RNA polymerase II promoter, ER-nuclear signaling pathway, response to unfolded protein, positive regulation of biosynthetic process, response to organic substance, positive regulation of macromolecule biosynthetic process,positive regulation of macromolecule metabolic process, positive regulation of gene expression, endoplasmic reticulum unfolded protein response, positive regulation of cellular biosynthetic process, RNA biosynthetic process, cellular response to stress, cellular response to unfolded protein, response to endoplasmic reticulum stress, regulation of transcription, positive regulation of transcription, DNA-dependent, positive regulation of nucleobase, nucleoside, nucleotide and nucleic acid metabolic process.
Preparation and Storage
Up to 1 year when aliquoted and stored at -20 to -80 °C.
Related Product Information for Nrf2 protein
Background: domain: Acidic activation domain in the N-terminus, and DNA binding domain in the C-terminus.,function:Transcription activator that binds to antioxidant response (ARE) elements in the promoter regions of target genes. Important for the coordinated up-regulation of genes in response to oxidative stress. May be involved in the transcriptional activation of genes of the beta-globin cluster by mediating enhancer activity of hypersensitive site 2 of the beta-globin locus control region.,PTM:Phosphorylation of Ser-40 by PKC in response to oxidative stress dissociates NFE2L2 from its cytoplasmic inhibitor KEAP1, promoting its translocation into the nucleus.,similarity:Belongs to the bZIP family.,similarity:Belongs to the bZIP family. CNC subfamily.,similarity:Contains 1 bZIP domain.,subcellular location:Cytosolic under unstressed conditions, translocates into the nucleus upon induction by electrophilic agents.,subunit:Heterodimer. May bind DNA with an unknown protein. Interacts with KEAP1. Interacts via its leucine-zipper domain with the coiled-coil domain of PMF1.,tissue specificity:Widely expressed. Highest expression in adult muscle, kidney, lung, liver and in fetal muscle.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
nuclear factor erythroid 2-related factor 2 isoform 2
NCBI Official Synonym Full Names
nuclear factor, erythroid 2 like 2
NCBI Official Symbol
NFE2L2
NCBI Official Synonym Symbols
NRF2; HEBP1; IMDDHH
NCBI Protein Information
nuclear factor erythroid 2-related factor 2
UniProt Protein Name
Nuclear factor erythroid 2-related factor 2
UniProt Gene Name
NFE2L2
UniProt Synonym Gene Names
NRF2; NF-E2-related factor 2; NFE2-related factor 2

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The Nrf2 nfe2l2 (Catalog #AAA268041) is a Protein and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: Amino acid: 11-130, with his-MBP tag. LPSQQDMDLI DILWRQDIDL GVSREVFDFS QRRKEYELEK QKKLEKERQE QLQKEQEKAF FAQLQLDEE TGEFLPIQPA QHIQSETSGS ANYSQVAHIP KSDALYFDDC M. It is sometimes possible for the material contained within the vial of "Nrf2, Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.