Ras-related protein Rab-8A Recombinant Protein | RAB8A recombinant protein
Recombinant Human Ras-related protein Rab-8A
Gene Names
RAB8A; MEL; RAB8
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Ras-related protein Rab-8A; N/A; Recombinant Human Ras-related protein Rab-8A; Oncogene c-mel; RAB8A recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
3-193aa; Partial
Sequence
KTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITP
Sequence Length
193
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for RAB8A recombinant protein
The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different sets of downstream effectors directly responsible for vesicle formation, movent, tethering and fusion. That Rab is involved in polarized vesicular trafficking and neurotransmitter release. Together with RAB11A, RAB3IP, the exocyst complex, PARD3, PRKCI, ANXA2, CDC42 and DNMBP promotes transcytosis of PODXL to the apical membrane initiation sites (AMIS), apical surface formation and lumenogenesis. Together with MYO5B and RAB11A participates in epithelial cell polarization. Plays an important role in ciliogenesis. Together with MICALL2, may also regulate adherens junction assembly. May play a role in insulin-induced transport to the plasma membrane of the glucose transporter GLUT4 and therefore play a role in glucose homeostasis.
Product Categories/Family for RAB8A recombinant protein
References
A small rab GTPase is distributed in cytoplasmic vesicles in non polarized cells but colocalizes with the tight junction marker ZO-1 in polarized epithelial cells.Zahraoui A., Joberty G., Arpin M., Fontaine J.J., Hellio R., Tavitian A., Louvard D.J. Cell Biol. 124:101-115(1994)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
37.8 kDa
NCBI Official Full Name
ras-related protein Rab-8A
NCBI Official Synonym Full Names
RAB8A, member RAS oncogene family
NCBI Official Symbol
RAB8A
NCBI Official Synonym Symbols
MEL; RAB8
NCBI Protein Information
ras-related protein Rab-8A
UniProt Protein Name
Ras-related protein Rab-8A
UniProt Gene Name
RAB8A
UniProt Synonym Gene Names
MEL; RAB8
UniProt Entry Name
RAB8A_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The RAB8A rab8a (Catalog #AAA81629) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 3-193aa; Partial. The amino acid sequence is listed below: KTYDYLFKLL LIGDSGVGKT CVLFRFSEDA FNSTFISTIG IDFKIRTIEL DGKRIKLQIW DTAGQERFRT ITTAYYRGAM GIMLVYDITN EKSFDNIRNW IRNIEEHASA DVEKMILGNK CDVNDKRQVS KERGEKLALD YGIKFMETSA KANINVENAF FTLARDIKAK MDKKLEGNSP QGSNQGVKIT P. It is sometimes possible for the material contained within the vial of "Ras-related protein Rab-8A, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
