Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA113302_SDS_PAGE15.jpg SDS-PAGE

E3 SUMO-protein ligase RanBP2 (RANBP2), partial Recombinant Protein | RANBP2 recombinant protein

Recombinant Human E3 SUMO-protein ligase RanBP2 (RANBP2), partial

Average rating 0.0
No ratings yet
Gene Names
RANBP2; ANE1; TRP1; TRP2; ADANE; IIAE3; NUP358
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
E3 SUMO-protein ligase RanBP2 (RANBP2), partial; N/A; Recombinant Human E3 SUMO-protein ligase RanBP2 (RANBP2), partial; E3 SUMO-protein ligase RanBP2; EC=6.3.2.-; 358 kDa nucleoporin; Nuclear pore complex protein Nup358; Nucleoporin Nup358; Ran-binding protein 2; RanBP2; p270; Including the following 1 domains:; Putative peptidyl-prolyl cis-trans isomerase; PPIase; EC=5.2.; RANBP2 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2601-2802aa; Partial
Sequence
PTEESSINYTFKTPEKAKEKKKPEDSPSDDDVLIVYELTPTAEQKALATKLKLPPTFFCYKNRPDYVSEEEEDDEDFETAVKKLNGKLYLDGSEKCRPLEENTADNEKECIIVWEKKPTVEEKAKADTLKLPPTFFCGVCSDTDEDNGNGEDFQSELQKVQEAQKSQTEEITSTTDSVYTGGTEVMVPSFCKSEEPDSITKS
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

product-image-AAA113302_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for RANBP2 recombinant protein
E3 SUMO-protein ligase which facilitates SUMO1 and SUMO2 conjugation by UBE2I. Involved in transport factor (Ran-GTP, karyopherin)-mediated protein import via the F-G repeat-containing domain which acts as a docking site for substrates. Binds single-stranded RNA (in vitro). May bind DNA. Component of the nuclear export pathway. Specific docking site for the nuclear export factor exportin-1. Sumoylates PML at 'Lys-490' which is essential for the proper assembly of PML-NB.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24.8 kDa
NCBI Official Full Name
E3 SUMO-protein ligase RanBP2
NCBI Official Synonym Full Names
RAN binding protein 2
NCBI Official Symbol
RANBP2
NCBI Official Synonym Symbols
ANE1; TRP1; TRP2; ADANE; IIAE3; NUP358
NCBI Protein Information
E3 SUMO-protein ligase RanBP2; P270; nucleoporin 358; nucleoporin Nup358; 358 kDa nucleoporin; ran-binding protein 2; transformation-related protein 2; nuclear pore complex protein Nup358; acute necrotizing encephalopathy 1 (autosomal dominant)
UniProt Protein Name
E3 SUMO-protein ligase RanBP2
UniProt Gene Name
RANBP2
UniProt Synonym Gene Names
NUP358; RanBP2
UniProt Entry Name
RBP2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The RANBP2 ranbp2 (Catalog #AAA113302) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2601-2802aa; Partial. The amino acid sequence is listed below: PTEESSINYT FKTPEKAKEK KKPEDSPSDD DVLIVYELTP TAEQKALATK LKLPPTFFCY KNRPDYVSEE EEDDEDFETA VKKLNGKLYL DGSEKCRPLE ENTADNEKEC IIVWEKKPTV EEKAKADTLK LPPTFFCGVC SDTDEDNGNG EDFQSELQKV QEAQKSQTEE ITSTTDSVYT GGTEVMVPSF CKSEEPDSIT KS. It is sometimes possible for the material contained within the vial of "E3 SUMO-protein ligase RanBP2 (RANBP2), partial, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.