Rho-related GTP-binding protein RhoD (RHOD) Recombinant Protein | RHOD recombinant protein
Recombinant Human Rho-related GTP-binding protein RhoD (RHOD)
Gene Names
RHOD; Rho; ARHD; RHOM; RHOHP1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Rho-related GTP-binding protein RhoD (RHOD); N/A; Recombinant Human Rho-related GTP-binding protein RhoD (RHOD); RHOD recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-207. Full Length of Mature Protein
Sequence
MTAAQAAGEEAPPGVRSVKVVLVGDGGCGKTSLLMVFADGAFPESYTPTVFERYMVNLQVKGKPVHLHIWDTAGQDDYDRLRPLFYPDASVLLLCFDVTSPNSFDNIFNRWYPEVNHFCKKVPIIVVGCKTDLCKDKSLVNKLRRNGLEPVTYHRGQEMARSVGAVAYLECSARLHDNVHAVFQEAAEVALSSRGRNFWRRITQGFC
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for RHOD recombinant protein
Ras homolog, or Rho, proteins interact with protein kinases and may serve as targets for activated GTPase. They play a critical role in muscle differentiation. This protein binds GTP and is a member of the small GTPase superfamily. It is involved in endosome dynamics and reorganization of the actin cytoskeleton, and it may coordinate membrane transport with the function of the cytoskeleton.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23,413 Da
NCBI Official Full Name
rho-related GTP-binding protein RhoD isoform 1
NCBI Official Synonym Full Names
ras homolog family member D
NCBI Official Symbol
RHOD
NCBI Official Synonym Symbols
Rho; ARHD; RHOM; RHOHP1
NCBI Protein Information
rho-related GTP-binding protein RhoD
UniProt Protein Name
Rho-related GTP-binding protein RhoD
UniProt Gene Name
RHOD
UniProt Synonym Gene Names
ARHD; RhoHP1
Similar Products
Product Notes
The RHOD rhod (Catalog #AAA115454) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-207. Full Length of Mature Protein. The amino acid sequence is listed below: MTAAQAAGEE APPGVRSVKV VLVGDGGCGK TSLLMVFADG AFPESYTPTV FERYMVNLQV KGKPVHLHIW DTAGQDDYDR LRPLFYPDAS VLLLCFDVTS PNSFDNIFNR WYPEVNHFCK KVPIIVVGCK TDLCKDKSLV NKLRRNGLEP VTYHRGQEMA RSVGAVAYLE CSARLHDNVH AVFQEAAEVA LSSRGRNFWR RITQGFC. It is sometimes possible for the material contained within the vial of "Rho-related GTP-binding protein RhoD (RHOD), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.