Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Coronavirus OC43 Spike glycoprotein (S) Recombinant Protein | S recombinant protein

Recombinant Human coronavirus OC43 Spike glycoprotein (S), partial

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Coronavirus OC43 Spike glycoprotein (S); N/A; Recombinant Human coronavirus OC43 Spike glycoprotein (S), partial; E2; Peplomer protein; S recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
318-624aa; Partial
Sequence
TVQPIADVYRRKPNLPNCNIEAWLNDKSVPSPLNWERKTFSNCNFNMSSLMSFIQADSFTCNNIDAAKIYGMCFSSITIDKFAIPNGRKVDLQLGNLGYLQSFNYRIDTTATSCQLYYNLPAANVSVSRFNPSTWNKRFGFIEDSVFKPRPAGVLTNHDVVYAQHCFKAPKNFCPCKLNGSCVGSGPGKNNGIGTCPAGTNYLTCDNLCTPDPITFTGTYKCPQTKSLVGIGEHCSGLAVKSDYCGGNSCTCRPQAFLGWSADSCLQGDKCNIFANFILHDVNSGLTCSTDLQKANTDIILGVCVNY
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for S recombinant protein
S1 attaches the virion to the cell membrane by interacting with sialic acid-containing cell receptors, initiating the infection. S2 is a class I viral fusion protein. Under the current model, the protein has at least 3 conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During viral and target cell membrane fusion, the coiled coil regions (heptad repeats) assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain. The formation of this structure appears to drive apposition and subsequent fusion of viral and target cell membranes.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39.6 kDa
NCBI Official Full Name
S protein
NCBI Official Symbol
S
NCBI Protein Information
spike surface glycoprotein
UniProt Protein Name
Spike glycoprotein
UniProt Gene Name
S
UniProt Synonym Gene Names
S glycoprotein
UniProt Entry Name
SPIKE_CVHOC

Similar Products

Product Notes

The S s (Catalog #AAA115887) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 318-624aa; Partial. The amino acid sequence is listed below: TVQPIADVYR RKPNLPNCNI EAWLNDKSVP SPLNWERKTF SNCNFNMSSL MSFIQADSFT CNNIDAAKIY GMCFSSITID KFAIPNGRKV DLQLGNLGYL QSFNYRIDTT ATSCQLYYNL PAANVSVSRF NPSTWNKRFG FIEDSVFKPR PAGVLTNHDV VYAQHCFKAP KNFCPCKLNG SCVGSGPGKN NGIGTCPAGT NYLTCDNLCT PDPITFTGTY KCPQTKSLVG IGEHCSGLAV KSDYCGGNSC TCRPQAFLGW SADSCLQGDK CNIFANFILH DVNSGLTCST DLQKANTDII LGVCVNY. It is sometimes possible for the material contained within the vial of "Coronavirus OC43 Spike glycoprotein (S), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.