Cystine/glutamate transporter (SLC7A11) Recombinant Protein | SLC7A11 recombinant protein

Recombinant Human Cystine/glutamate transporter (SLC7A11)(Active)

Cat. Num. AAA279391

• Gene Names: SLC7A11; xCT; CCBR1
• Purity: Greater than 90% as determined by SDS-PAGE.
• Synonyms: Cystine/glutamate transporter (SLC7A11); N/A; Recombinant Human Cystine/glutamate transporter (SLC7A11)(Active); Amino acid transport system xc- (Calcium channel blocker resistance protein CCBR1)(Solute carrier family 7 member 11)(xCT); SLC7A11 recombinant protein

• Host: E coli (in vitro)
• Purity/Purification: Greater than 90% as determined by SDS-PAGE.
• Form/Format: Liquid or Lyophilized powder. If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Sequence: MVRKPVVSTISKGGYLQGNVNGRLPSLGNKEPPGQEKVQLKRKVTLLRGVSIIIGTIIGAGIFISPKGVLQNTGSVGMSLTIWTVCGVLSLFGALSYAELGTTIKKSGGHYTYILEVFGPLPAFVRVWVELLIIRPAATAVISLAFGRYILEPFFIQCEIPELAIKLITAVGITVVMVLNSMSVSWSARIQIFLTFCKLTAILIIIVPGVMQLIKGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFVTEEVENPEKTIPLAICISMAIVTIGYVLTNVAYFTTINAEELLLSNAVAVTFSERLLGNFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGHLPEILSMIHVRKHTPLPAVIVLHPLTMIMLFSGDLDSLLNFLSFARWLFIGLAVAGLIYLRYKCPDMHRPFKVPLFIPALFSFTCLFMVALSLYSDPFSTGIGFVITLTGVPAYYLFIIWDKKPRWFRIMSEKITRTLQIILEVVPEEDKL
• Sequence Length: 1-501aa; Full Length

• Species: Homo sapiens (Human)
• Tag: N-terminal 10xHis-tagged
• Transmembrane Domain: 12TM
• Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human SLC7A11 at 2ug/mL can bind Anti-SLC7A11 recombinant antibody , the EC50 is 9.452-13.79ng/mL.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Preparation and Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.; Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

LC-MS

(Loaded Anti-Human SLC7A11 Antibody on 96-Flat plate, can bind Human SLC7A11, with an affinity constant of ?1 pM as determined in BLI assay (Gator Prime).)

SDS-PAGE

((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)

Bioactivity

Product Categories/Family for SLC7A11 recombinant protein

Cell Biology

NCBI and Uniprot Product Information

• NCBI GI #: 7657683
• NCBI GeneID: 23657
• NCBI Accession #: NP_055146.1
• NCBI GenBank Nucleotide #: NM_014331.3
• UniProt Accession #: Q9UPY5; A8K2U4
• Molecular Weight: 55,423 Da
• NCBI Official Full Name: cystine/glutamate transporter
• NCBI Official Synonym Full Names: solute carrier family 7 (anionic amino acid transporter light chain, xc- system), member 11
• NCBI Official Symbol: SLC7A11
• NCBI Official Synonym Symbols: xCT; CCBR1
• NCBI Protein Information: cystine/glutamate transporter; amino acid transport system xc-; calcium channel blocker resistance protein CCBR1; solute carrier family 7 member 11; solute carrier family 7, (cationic amino acid transporter, y+ system) member 11
• UniProt Protein Name: Cystine/glutamate transporter
• UniProt Gene Name: SLC7A11
• UniProt Entry Name: XCT_HUMAN