Cystine/glutamate transporter (SLC7A11) Recombinant Protein | SLC7A11 recombinant protein
Recombinant Human Cystine/glutamate transporter (SLC7A11)(Active)
Gene Names
SLC7A11; xCT; CCBR1
Purity
Greater than 90% as determined by SDS-PAGE.
Synonyms
Cystine/glutamate transporter (SLC7A11); N/A; Recombinant Human Cystine/glutamate transporter (SLC7A11)(Active); Amino acid transport system xc- (Calcium channel blocker resistance protein CCBR1)(Solute carrier family 7 member 11)(xCT); SLC7A11 recombinant protein
Host
E coli (in vitro)
Purity/Purification
Greater than 90% as determined by SDS-PAGE.
Form/Format
Liquid or Lyophilized powder. If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Sequence
MVRKPVVSTISKGGYLQGNVNGRLPSLGNKEPPGQEKVQLKRKVTLLRGVSIIIGTIIGAGIFISPKGVLQNTGSVGMSLTIWTVCGVLSLFGALSYAELGTTIKKSGGHYTYILEVFGPLPAFVRVWVELLIIRPAATAVISLAFGRYILEPFFIQCEIPELAIKLITAVGITVVMVLNSMSVSWSARIQIFLTFCKLTAILIIIVPGVMQLIKGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFVTEEVENPEKTIPLAICISMAIVTIGYVLTNVAYFTTINAEELLLSNAVAVTFSERLLGNFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGHLPEILSMIHVRKHTPLPAVIVLHPLTMIMLFSGDLDSLLNFLSFARWLFIGLAVAGLIYLRYKCPDMHRPFKVPLFIPALFSFTCLFMVALSLYSDPFSTGIGFVITLTGVPAYYLFIIWDKKPRWFRIMSEKITRTLQIILEVVPEEDKL
Sequence Length
1-501aa; Full Length
Species
Homo sapiens (Human)
Tag
N-terminal 10xHis-tagged
Transmembrane Domain
12TM
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized Human SLC7A11 at 2ug/mL can bind Anti-SLC7A11 recombinant antibody , the EC50 is 9.452-13.79ng/mL.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for SLC7A11 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
55,423 Da
NCBI Official Full Name
cystine/glutamate transporter
NCBI Official Synonym Full Names
solute carrier family 7 (anionic amino acid transporter light chain, xc- system), member 11
NCBI Official Symbol
SLC7A11
NCBI Official Synonym Symbols
xCT; CCBR1
NCBI Protein Information
cystine/glutamate transporter; amino acid transport system xc-; calcium channel blocker resistance protein CCBR1; solute carrier family 7 member 11; solute carrier family 7, (cationic amino acid transporter, y+ system) member 11
UniProt Protein Name
Cystine/glutamate transporter
UniProt Gene Name
SLC7A11
UniProt Entry Name
XCT_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The SLC7A11 slc7a11 (Catalog #AAA279391) is a Recombinant Protein produced from E coli (in vitro) and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MVRKPVVSTI SKGGYLQGNV NGRLPSLGNK EPPGQEKVQL KRKVTLLRGV SIIIGTIIGA GIFISPKGVL QNTGSVGMSL TIWTVCGVLS LFGALSYAEL GTTIKKSGGH YTYILEVFGP LPAFVRVWVE LLIIRPAATA VISLAFGRYI LEPFFIQCEI PELAIKLITA VGITVVMVLN SMSVSWSARI QIFLTFCKLT AILIIIVPGV MQLIKGQTQN FKDAFSGRDS SITRLPLAFY YGMYAYAGWF YLNFVTEEVE NPEKTIPLAI CISMAIVTIG YVLTNVAYFT TINAEELLLS NAVAVTFSER LLGNFSLAVP IFVALSCFGS MNGGVFAVSR LFYVASREGH LPEILSMIHV RKHTPLPAVI VLHPLTMIML FSGDLDSLLN FLSFARWLFI GLAVAGLIYL RYKCPDMHRP FKVPLFIPAL FSFTCLFMVA LSLYSDPFST GIGFVITLTG VPAYYLFIIW DKKPRWFRIM SEKITRTLQI ILEVVPEEDK L. It is sometimes possible for the material contained within the vial of "Cystine/glutamate transporter (SLC7A11), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
